GE Profile™ 30" Smart Built-In Twin Flex Convection Wall Oven
Owner's manual for the GE Profile PTS9200SZSS 30" Smart Built-In Wall Oven, covering safety information, Wi-Fi connectivity setup via the SmartHQ app, appliance settings, cooking modes, probe use, cleaning and care, troubleshooting, warranty, and accessories.
Frequently Asked Questions
How do I connect the oven to Wi-Fi?
Download the SmartHQ mobile app, sign in or create an account, and follow the prompts on the appliance's control display. Have your home Wi-Fi network password available before starting. New users must verify their email address to complete sign-in.
Where can I find the appliance's network name and password if needed?
Reference the connected appliance information label, typically located inside the door of the oven or drawer, which also contains the Appliance Network Name and Password.
How do I turn off the Wi-Fi on the oven?
If the oven has a Remote Enable or Wi-Fi Connect button, press and hold the button for 3 seconds to fully disconnect.
Where can I find the model and serial numbers?
They are located on a label on the side trim or on the front of the lower oven behind the oven door.
What should I do if there is a fire in the oven while baking?
Smother the fire by closing the oven door and turning the oven off, or use a multi-purpose dry chemical or foam-type fire extinguisher.
Is it safe to use foil or oven liners on the oven bottom?
No, do not use any type of foil or liner to cover the oven bottom or anywhere in the oven except as described in the Owner's Manual, as it can trap heat or melt, causing damage or risk of shock, smoke, or fire.
Manual text content
Write the model and serial numbers here: Model # _________________ Serial # _________________ You can find them on a label on the side trim or on the front of the (lower) oven behind the oven door. OWNER’S MANUAL WALL OVEN Built-In Electric 49-2003957 Rev. 0 04-26 GE is a trademark of the General Electric Company. Manufactured under trademark license. Wall Oven PTS9200 ENGLISH / FRANÇAIS / ESPAÑOL SAFETY INFORMATION . . . . . . . . . .3 USING THE APPLIANCE Wi-Fi Connectivity . . . . . . . . . . . . . . . . . . . .6 Appliance Display. . . . . . . . . . . . . . . . . . . . . .7 Settings . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .9 Sabbath . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10 Oven Racks . . . . . . . . . . . . . . . . . . . . . . . . . . 11 Aluminum Foil and Oven Liners . . . . . . . . . 12 Cookware Guidelines . . . . . . . . . . . . . . . . . . 12 Cooking Modes . . . . . . . . . . . . . . . . . . . . . . . 13 Probe . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17 Cooking Guide . . . . . . . . . . . . . . . . . . . . . . . 18 Air Fry Cooking Guide . . . . . . . . . . . . . . . . 20 CARE AND CLEANING Cleaning The Oven - Exterior . . . . . . . . . . . 21 Cleaning The Oven - Interior . . . . . . . . . . .22 Probe . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .23 Oven Racks . . . . . . . . . . . . . . . . . . . . . . . . . .23 Oven Light . . . . . . . . . . . . . . . . . . . . . . . . . . 24 Oven Door . . . . . . . . . . . . . . . . . . . . . . . . . . .25 TROUBLESHOOTING TIPS . . . . . 26 LIMITED WARRANTY . . . . . . . . . . .28 ACCESSORIES . . . . . . . . . . . . . . . . . . 29 CONSUMER SUPPORT . . . . . . . . . 30 THANK YOU FOR MAKING GE APPLIANCES A PART OF YOUR HOME. Whether you grew up with GE Appliances, or this is your first, we’re happy to have you in the family. We take pride in the craftsmanship, innovation and design that goes into every GE Appliances product, and we think you will too. Among other things, registration of your appliance ensures that we can deliver important product information and warranty details when you need them. Register your GE appliance now online. Helpful websites and phone numbers are available in the Consumer Support section of this Owner’s Manual. You may also mail in the pre-printed registration card included in the packing material. 49-2003957 Rev. 0 3 READ AND SAVE THESE INSTRUCTIONS IMPORTANT SAFETY INFORMATION READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE SAFETY INFORMATION WARNING GENERAL SAFETY INSTRUCTIONS Ŷ 8VHWKLVDSSOLDQFHRQO\IRULWVLQWHQGHGSXUSRVHDV described in the Owner’s Manual. Ŷ +DYH\RXUDSSOLDQFHLQVWDOOHGDQGSURSHUO\ grounded by a qualified installer in accordance with the provided installation instructions. Ŷ $Q\DGMXVWPHQWUHSDLURUVHUYLFHQRWVSHFLILFDOO\ recommended in the Owner’s Manual should be performed ONLY by a qualified appliance installer or service technician. Ŷ %HIRUHSHUIRUPLQJDQ\VHUYLFHXQSOXJWKHDSSOLDQFH or disconnect the power supply at the household distribution panel by removing the fuse or switching off the circuit breaker. Ŷ %HVXUHDOOSDFNLQJPDWHULDOVDUHUHPRYHGIURPWKH appliance before operating to prevent ignition of these materials. Ŷ $YRLGVFUDWFKLQJRULPSDFWLQJJODVVGRRUV cooktops, or control panels. Doing so may lead to glass breakage. Ŷ 'RQRWFRRNRQDSURGXFWZLWKEURNHQJODVV6KRFN fire, or cuts may occur. Ŷ 'RQRWOHDYHFKLOGUHQDORQHRUXQDWWHQGHGLQDQ area where an appliance is in use. They should never be allowed to climb, sit or stand on any part of the appliance. Ŷ CAUTION Do not store items of interest to children in cabinets above or on top of the appliance - children climbing on the oven to reach LWHPVFRXOGEHVHULRXVO\LQMXUHG Ŷ 1HYHUXVH\RXUDSSOLDQFHIRUZDUPLQJRUKHDWLQJ the room. Ŷ 'RQRWDOORZDQ\RQHWRFOLPEVWDQGRUKDQJRQWKH oven door, drawer, or cooktop. They could damage WKHDSSOLDQFHRUWLSLWRYHUFDXVLQJVHYHUHLQMXU\RU death. Ŷ 8VHRQO\GU\SRWKROGHUV²PRLVWRUGDPSSRWKROGHUV on hot surfaces may result in burns from steam. Do not let pot holders touch surface units or oven heating elements. Do not use a towel or other bulky cloth in place of pot holders. Ŷ 'RQRWWRXFKWKHEXUQHUVJULGGOHV RQVRPH PRGHOV JUDWHV RQVRPHPRGHOV WKHFRRNWRSRU oven heating elements, or the interior surface of the oven. These surfaces may remain hot enough to burn for an extended period of time following cooking, even though they no longer appear to be on or hot. Ŷ 'XULQJDQGDIWHUXVHGRQRWWRXFKRUOHWFORWKLQJRU other flammable materials contact any interior area of the oven; allow sufficient time for cooling first. Other surfaces of the appliance may become hot enough to cause burns. Potentially hot surfaces include burners RUKHDWLQJHOHPHQWVJUDWHV RQVRPHPRGHOV cooktop surface, oven vent openings, surfaces near the openings, crevices around the oven door, metal trim parts above the door, any backguard, or shelves located above cooking surface. Ŷ 'RQRWKHDWXQRSHQHGIRRGFRQWDLQHUV3UHVVXUH could build up and the container could burst, causing DQLQMXU\ Ŷ &RRNIRRGWKRURXJKO\WRKHOSSURWHFWDJDLQVW foodborne illness. Minimum safe food temperature UHFRPPHQGDWLRQVDUHSURYLGHGE\WKH86'$ DQG)'$8VHDIRRGWKHUPRPHWHUWRWDNHIRRG temperatures and check several locations. Ŷ .HHSWKHYHQWLODWRUKRRGDQGJUHDVHILOWHUVFOHDQWR maintain good venting and to avoid grease fires. Turn the ventilator OFF in case of a fire. The blower if in operation, could spread the flames. WARNING KEEP FLAMMABLE MATERIALS AWAY FROM THE OVEN Failure to do so may result in fire or personal injury. Ŷ 'RQRWVWRUHRUXVHIODPPDEOHPDWHULDOVLQDQRYHQ or near the cooktop, including paper, plastic, pot holders, linens, wall coverings, curtains, drapes and gasoline or other flammable vapors and liquids. Ŷ 1HYHUZHDUORRVHILWWLQJRUKDQJLQJJDUPHQWVZKLOH using the appliance. These garments may ignite if they contact hot surfaces causing severe burns. Ŷ 'RQRWOHWFRRNLQJJUHDVHRURWKHUIODPPDEOH materials accumulate in or near the appliance. Grease in the oven or on the cooktop may ignite. Ŷ 'RQRWVWRUHDQ\IODPPDEOHPDWHULDOVRU temperature sensitive items inside of or on the appliance. Ŷ &OHDQYHQWLODWLQJKRRGVIUHTXHQWO\*UHDVHVKRXOG not be allowed to accumulate on the hood or filter. Ŷ 2QVRPHPRGHOV 5HPRWH2SHUDWLRQ±7KLV appliance is configurable to allow remote operation at any time. WARNING Read all safety instructions before using the product. Failure to follow these instructions may UHVXOWLQILUHHOHFWULFDOVKRFNVHULRXVLQMXU\RUGHDWK 4 49-2003957 Rev. 0 SAFETY INFORMATION READ AND SAVE THESE INSTRUCTIONS IMPORTANT SAFETY INFORMATION READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE WARNING KEEP FLAMMABLE MATERIALS AWAY FROM THE APPLIANCE Failure to do so may result in fire or personal injury. Ŷ 'RQRWVWRUHRUXVHIODPPDEOHPDWHULDOVLQDQRYHQ or near the cooktop, including paper, plastic, pot holders, linens, wall coverings, curtains, drapes and gasoline or other flammable vapors and liquids. Ŷ 1HYHUZHDUORRVHILWWLQJRUKDQJLQJJDUPHQWVZKLOH using the appliance. These garments may ignite if they contact hot surfaces causing severe burns. Ŷ 'RQRWOHWFRRNLQJJUHDVHRURWKHUIODPPDEOH materials accumulate in or near the appliance. Grease in the oven or on the cooktop may ignite. Ŷ Do not store any flammable materials or temperature sensitive items inside of or on the appliance. Ŷ Clean ventilating hoods frequently. Grease should not be allowed to accumulate on the hood or filter. Ŷ 2QVRPHPRGHOV Remote Operation ±7KLV appliance is configurable to allow remote operation at any time. WARNING IN THE EVENT OF A FIRE, TAKE THE FOLLOWING STEPS TO PREVENT INJURY AND FIRE SPREADING Ŷ 'RQRWXVHZDWHURQJUHDVHILUHV1HYHUSLFNXS a flaming pan. Turn the controls off. Smother a flaming pan on a surface unit by covering the pan completely with a well-fitting lid, cookie sheet or flat WUD\8VHDPXOWLSXUSRVHGU\FKHPLFDORUIRDPW\SH fire extinguisher. Ŷ ,IWKHUHLVDILUHLQWKHRYHQGXULQJEDNLQJVPRWKHU the fire by closing the oven door and turning the oven off or by using a multi-purpose dry chemical or foam-type fire extinguisher. Ŷ 2QVRPHPRGHOV ,IWKHUHLVDILUHLQWKHRYHQ during self-clean, turn the oven off and wait for the fire to go out. Do not force the door open. ,QWURGXFWLRQRIIUHVKDLUDWVHOIFOHDQWHPSHUDWXUHV may lead to a burst of flame from the oven. Failure to follow this instruction may result in severe burns. WARNING OVEN SAFETY INSTRUCTIONS Ŷ 6WDQGDZD\IURPWKHDSSOLDQFHZKHQRSHQLQJWKH oven door. Hot air or steam which escapes can cause burns to hands, face and/or eyes. Ŷ 'RQRWXVHWKHRYHQLIDKHDWLQJHOHPHQWGHYHORSV a glowing spot during use or shows other signs of damage. A glowing spot indicates the heating element may fail and present a potential burn, fire, or shock hazard. Turn the oven off immediately and have the heating element replaced by a qualified service technician. Ŷ .HHSWKHRYHQYHQWXQREVWUXFWHG Ŷ 1HYHUSODFHFRRNLQJXWHQVLOVSL]]DRUEDNLQJ stones, or any type of foil or liner on the oven floor. These items can trap heat or melt, resulting in damage to the product and risk of shock, smoke or fire. Ŷ 3ODFHRYHQUDFNVLQGHVLUHGORFDWLRQZKLOHRYHQLV FRRO,IUDFNPXVWEHPRYHGZKLOHRYHQLVKRWEH careful to avoid touching hot surfaces and do not let pot holder contact hot heating element in oven. Ŷ 'RQRWOHDYHLWHPVVXFKDVSDSHUFRRNLQJXWHQVLOV RUIRRGLQWKHRYHQZKHQQRWLQXVH,WHPVVWRUHGLQ an oven can ignite. Ŷ 'RQRWOHDYHLWHPVRQWKHFRRNWRSQHDUWKHRYHQ YHQW,WHPVPD\RYHUKHDWUHVXOWLQJLQDULVNRIILUHRU burns. Ŷ 1HYHUEURLOZLWKWKHGRRURSHQ Ŷ .HHSWKHRYHQIUHHIURPJUHDVHEXLOGXS*UHDVHLQ the oven may ignite. Ŷ :KHQXVLQJFRRNLQJRUURDVWLQJEDJVLQWKHRYHQ follow the manufacturer’s directions. Ŷ SHOCK OR BURN HAZARD: %HIRUHUHSODFLQJ oven light bulb, disconnect the electrical power to the appliance at the main fuse or circuit breaker panel. Failure to do so may result in electric shock or burn. Ŷ CAUTION BURN HAZARD: The glass cover and bulb should be removed when cool. Touching hot glass with bare hands or a damp cloth can cause burns. Ŷ 'RQRWXVHDQ\W\SHRIIRLORUOLQHUWRFRYHUWKH oven bottom or anywhere in the oven, except as described in the Owner’s Manual. Oven liners can trap heat or melt, resulting in damage to the product and risk of shock, smoke or fire. 49-2003957 Rev. 0 5 SAFETY INFORMATION READ AND SAVE THESE INSTRUCTIONS IMPORTANT SAFETY INFORMATION READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE PROPER DISPOSAL OF YOUR APPLIANCE Dispose of or recycle your appliance in accordance with Federal and Local Regulations. Contact your local authorities for the environmentally safe disposal or recycling of your appliance. REGULATORY INFORMATION FCC/IC Compliance Statement: 7KLVGHYLFHFRPSOLHVZLWK3DUWRIWKH)&&5XOHV2SHUDWLRQLVVXEMHFWWRWKHIROORZLQJFRQGLWLRQV 1. This device may not cause harmful interference, and 7KLVGHYLFHPXVWDFFHSWDQLQWHUIHUHQFHUHFHLYHGLQFOXGLQJLQWHUIHUHQFHWKDWPD\FDXVHXQGHVLUHGRSHUDWLRQ NOTICE: Changes or modifications to this unit not expressly approved by the manufacturer could void the use's authority to operate the equipment. How to Remove Protective Shipping Film and Packaging Tape Carefully grasp a corner of the protective shipping film with your fingers and slowly peel it from the appliance surface. Do not use any sharp items to remove the film. Remove all of the film before using the appliance for the first time. To assure no damage is done to the finish of the product, the safest way to remove the adhesive from packaging tape on new appliances is an application of a household liquid dishwashing detergent. Apply with a soft cloth and allow to soak. NOTE: All protective packing must be removed from all SDUWV,WFDQQRWEHUHPRYHGLILWLVEDNHGRQ Consider recycling options for your appliance packaging material. WARNING RQVRPHPRGHOV 7KLVRYHQPD\EHHTXLSSHGZLWKDPLFURSKRQHWRDOORZIRUYRLFHFRQWURORI your oven's operations. Enabling use of the microphone will cause it to be capable of listening for certain voice FRPPDQGVWRDFWLYDWHDQGRSHUDWHWKHRYHQDWDOOWLPHV,WLVSRVVLEOHIRUEDFNJURXQGRUHQYLURQPHQWDOQRLVH to mimic words or sounds that this appliance recognizes as an instruction, and the unit may activate or initiate a feature or cooking mode as a result, even when the unit is unattended and no activation of the feature or cooking mode was desired. Never store flammable or temperature-sensitive items inside of the appliance. 6 49-2003957 Rev. 0 USING THE APPLIANCE: Wi-Fi Connectivity Wi-Fi Connectivity Your appliance is designed to provide you with two- way communication between your appliance and smart GHYLFHV,QDGGLWLRQWKLVDSSOLDQFHPD\UHTXLUHD software update to enable all features on initial setup. %\XVLQJWKH6PDUW+4 TM mobile app, you will be able to FRQQHFWWRDYDULHW\RIIHDWXUHV LQFOXGLQJEXWQRWOLPLWHG to using your appliance as a smart speaker with Amazon Alexa) and a using your smartphone or tablet*. Visit your DSSVWRUHDQGGRZQORDG6PDUW+4RUXVHWKH45FRGH EHORZ To connect your appliance to Wi-Fi, follow the prompts on the appliances controls display. For the best H[SHULHQFHSULRUWREHJLQQLQJ ā 'RZQORDGWKH6PDUW+4DSSDQGVLJQLQRUFUHDWHDQ account. NOTE: New users must verify their email address to complete the sign in process. · Have your home Wi-Fi network password available. ,ID0$&,'LVUHTXLUHGWRFRQQHFW\RXUDSSOLDQFHWR Wi-Fi see the Settings section for details. You can also reference the connected appliance information label typically located inside the door of the oven or drawer. ,WZLOODOVRFRQWDLQWKH$SSOLDQFH1HWZRUN1DPHDQG Password, should it be needed. 2QFH\RXUDSSOLDQFHLVFRQQHFWHGODXQFKWKH6PDUW+4 app and tap on your appliance to explore. Apply all software upgrades if prompted to ensure your appliance has the latest features. NOTE: Make sure to keep the Wi-Fi function turned on so that you can control your appliance from your 6PDUW+4DSS ,I\RXKDYHLVVXHVZLWKWKHFRQQHFWLRQSURFHVVSOHDVH FDOODQGDVNIRUDVVLVWDQFHZLWKZLUHOHVV connectivity. * Compatible Apple or Android devices and home Wi-Fi network required. Turning Off the Wi-Fi ,I\RXKDYHD5HPRWH(QDEOHRU:L)L&RQQHFWEXWWRQ press and hold the button for 3 seconds to fully GLVFRQQHFWIURPWKH:L)L,I\RXGRQRWKDYHDEXWWRQ on your controls, navigate to Settings and disconnect or forget network to fully disconnect from the Wi-Fi. NOTE: <RXZLOOKDYHWRUHFRQQHFW\RXU6PDUW+4DSSWR\RXU appliance if you would like to control your appliance from \RXUSKRQHDJDLQ1RWHWKDWZKHQWKH:,)LLVWXUQHGRII the oven Wi-Fi board is not broadcasting. Available Features Follow all in-app instructions for proper operation of the appliance when using connected features. Remote Oven Control: 7RHQDEOH6PDUW+4FRQWURORIWKHRYHQZKLOH:L)LLV active, ensure the feature is on by checking the remote enable setting in Settings. Voice to Activate: You have the power to control your oven operation with MXVW\RXUYRLFH You can use your voice to turn on an oven and oven timers or turn off an oven. Make sure that your oven LVFRQQHFWHGWR:L)LFRQQHFWHGWRWKH6PDUW+4$SS oven remote enable is turned on and your oven control is unlocked. Also ensure that you are connected to an Amazon Alexa smart speaker and the smart speaker is within close proximity to your oven so it hears your commands. NOTE: Some cooking functions and features are not available until after you Wi-Fi connect your new oven to your local home wireless network. Please follow the instructions above to connect. This provides capability to XVH6PDUW+4DSSIXQFWLRQVDQGHQVXUHVWKDWWKHRYHQ has the latest software. Contains FCC: UPD ID: PT. NO. Contains IC: MAC ID: Connected Appliance Information 49-2003957 Rev. 0 7 Appliance Display HOME SCREEN 1 - Oven Control Located on the far left of the Oven Display Home Screen. Make sure to swipe all the way over to the left if it is not displayed when the Oven Display wakes up. Upper Oven and Lower Oven You can use different cooking modes in each oven. First select the oven to use then select the cooking mode desired. Cooking Mode Selection Screen Select your cooking preference in this area. You can select between traditional oven modes or precision oven modes. See the Cooking Modes section for more details on the different traditional and precision cooking modes available. Make sure to connect your oven so that you can download new precision cooking modes as they are available. 2 - Quick Settings Shade Swipe this menu down to access oven lights, control ORFNPLFURSKRQH RQVRPHPRGHOV VSHDNHUVGLVSOD\ brightness, Ambient menu layout, alerts, and settings. Oven Light To turn on or off the oven cavity lights, press the . Lock Controls Select this option to lock the oven control from any undesired screen selections. To lock, press the button. Press and hold the button to unlock. Brightness 8VHWKHVOLGHUEDUWRDGMXVWVFUHHQEULJKWQHVVWRGHVLUHG setting. Ambient Press the Ambient button to go directly to the Ambient screen. Settings Press the Settings button to access the Settings Menu. See the Settings section for a full list of what is available. My Oven Oven Meal Planning Stay Informed Tools 1:59 PM 1 2 3 4 5 USING THE APPLIANCE: Appliance Display 8 49-2003957 Rev. 0 Appliance Display 3 - Status Bar The upper right hand corner, displays active alerts, PLFURSKRQHVWDWXV RQVRPHPRGHOV :L)LVWDWXVDQG WLPH8VHWKLVDVDTXLFNUHIHUHQFHZKHQXVLQJWKH oven. 4 - Navigation Bar Back Arrow This takes you back one screen until you reach the Home screen. Home Button Takes you directly to the Home Screen with the Oven Control section viewable. Oven button / Oven buttons This takes you to the oven screen showing what is UXQQLQJLIWKHRYHQLVEHLQJXVHG,IWKHRYHQVHOHFWHG is not being used, it will take you to the mode selection screen for the oven selected. Activity Bar Located at the bottom of the Appliance Display, this indicates that the oven is currently turned on. This bar does not display when the oven is turned off. This feature only displays when oven is turned on. 5 - Apps Connect your oven to capture the full functionality of the apps on your control. Some apps can only be used if your oven is connected to Wi-Fi. Example apps include weather and kitchen timer. Swipe to the right to access more apps as well as the 6PDUW+4DVVLVWDQW RQPLFURSKRQHFDSDEOHPRGHOV only) and Oven Tips information. Timers The timer app works as a countdown timer. You can set a new timer or select an existing timer. Select Add a Timer or Timer , set the timer duration KRXUVPLQXWHVVHFRQGVQDPHWKHWLPHULI\RXZDQWWR reuse it, then start the timer. Once a timer is started, the timer name cannot be changed. Multiple timers can be set and reused independently or at the same time. ,IPRUHWKDQWZRWLPHUVDUHVHWDWWKHVDPHWLPHWKHWZR most recently set timers will display in the Apps section. To view all active timers and all timers previously set, select the timer app to access the list and swipe to view active timers, reuse a timer or delete a timer. The Appliance Display will notify you when a timer is complete. HOME SCREEN (Cont.) USING THE APPLIANCE: Appliance Display 49-2003957 Rev. 0 USING THE APPLIANCE: Settings Settings Set Clock 7KLVIHDWXUH RQO\DYDLODEOHZKHQQRWFRQQHFWHG DOORZV you to set the clock and specifies how the time of day ZLOOEHGLVSOD\HG2SWLRQVDUHIRUDVWDQGDUGKRXU FORFNZLWK$0DQG30VHOHFWLRQVRUKRXUPLOLWDU\WLPH display. Sounds & Alerts This setting screen allows you to change the volume, the end of cycle alert, and turn on or off the touch sound. Display & Appearance This screen shows the options for brightness and Energy saver. Appliance Settings Ŷ TEMPERATURE UNITS: The oven is set to Fahrenheit, however, in this setting the cooking unit can be changed to Celsius. Ŷ ADJUST OVEN TEMPERATURE: $GMXVW2YHQ Temperature allows the oven temperature to be DGMXVWHGXSWR)KRWWHURUGRZQWR)FRROHU 8VHWKLVIHDWXUHLI\RXEHOLHYH\RXURYHQWHPSHUDWXUH is too hot or cold and wish to change it. For double ovens, the upper and lower oven temperatures are DGMXVWHGVHSDUDWHO\'RQRWXVHWKHUPRPHWHUV such as those found in grocery stores, to check the temperature setting of your oven. These WKHUPRPHWHUVPD\YDU\±GHJUHHV Ŷ AUTO RECIPE CONVERSION: Auto Recipe Conversion can be turned on in order to automatically reduce the programmed cooking temperature for &RQYHFWLRQ%DNHRU&RQYHFWLRQ%DNH0XOWL1RWHWKDW this will only reduce the cooking temperature, not the baking time. Ŷ 12 HOUR SHUT OFF: :KHQWKH+RXU6KXW2II option is turned on, it will automatically shut off the RYHQDIWHUKRXUVRIFRQWLQXRXVXVH Ŷ OVEN LIGHT TIMEOUT: Turn this feature on to have the oven light turn off automatically after cooking is completed and the oven turned off. SmartHQ Account $OORZV\RXWRORJLQWR\RXU6PDUW+4DFFRXQWRQ\RXU oven. This feature also helps with connecting your oven WR\RXU6PDUW+4$FFRXQW Wi-Fi Allows you connect to or forget your Wi-Fi network. Remote Enable Turn this feature on to control your oven remotely via the app once your oven is connected. Ambient Mode Allows you to configure the ambient screen. System This screen allows you to clear your saved user data and VKRZVWKHFXUUHQWVRIWZDUHYHUVLRQVDQGWKH0$&,' 10 49-2003957 Rev. 0 Settings Sabbath Mode <RXUUDQJHRIIHUVD6DEEDWKPRGHWKDWFRPSOLHVZLWKVWDQGDUGVVHWIRUWKE\2UWKRGR[8QLRQWKH&HQWUDO5DEELQLFDO &RQJUHVVDQG+DODFKD7HFKLVFHUWLILHGWRWKHKLJKHVWKDODFKDVWDQGDUGV,QWKLVPRGHWKHRYHQOLJKWVZLOOEH turned off for the duration of use and oven tones will be disabled. NOTE: Ensure the oven clock is accurate before entering the mode. For proper Sabbath operation, the mode must be started within 1-hour window before sunset. Using the Sabbath Mode Navigate to the Settings menu and select Sabbath . Select the desired Sabbath Mode or Holiday Mode combination from the options provided and press Start . The display will indicate which Sabbath or Holiday mode is operating. Options with Holiday and Sabbath with automatically transition between the functions based on the initial time entered within the 1-hour window before sunset. )RU6DEEDWK:DUPRSWLRQVOHVVWKDQKRXUVWKH appliance will complete the Sabbath Warm function and WUDQVLWLRQWR6DEEDWK,GOHIRUWKHUHPLQGHURIWKHKRXU period. The oven lights will remain turned off, oven tones will remain disabled, oven heating will be disabled, and the display will show the oven idle. Sabbath Mode Power Outage ,IDSRZHURXWDJHRFFXUVGXULQJWKHXVHRI6DEEDWK Warm or Holiday modes, the appliance will return to Sabbath Warm for the remainder of the chosen VFKHGXOH,IWKHRXWDJHRFFXUVGXULQJ6DEEDWK,GOHWKH DSSOLDQFHZLOOUHWXUQWR6DEEDWK,GOHIRUWKHUHPDLQGHURI the chosen schedule. Sabbath Warm Temperature 8VHWKH6HWWLQJVRSWLRQ6DEEDWK:DUPHUWRLQFUHDVHWKH Sabbath Warm energy if the oven is operating cooler WKDQGHVLUHGRULI\RXURYHQLVRSHUDWLQJRQYROWDJH Go to Appliance Settings , select Sabbath Warm Temperature . USING THE APPLIANCE: Settings 49-2003957 Rev. 0 11 USING THE APPLIANCE: Oven Racks Oven Racks Recommended rack positions for various types of IRRGVDUHSURYLGHGLQWKH&RRNLQJ*XLGH$GMXVWLQJ rack position is one way to impact cooking results. For example, if you would prefer darker tops on cakes, muffins, or cookies, try moving food one rack position KLJKHU,I\RXILQGIRRGVDUHWRREURZQRQWRSWU\PRYLQJ them down next time. When baking with multiple pans and on multiple racks, ensure there is sufficient space between pans to allow air to flow. To avoid possible burns, place the racks in the desired position before you turn the oven on. For Tall Loads in Lower Oven Remove extension racks from oven. Place provided rack on the bottom of the oven as shown. Note that this rack will not slide into guides on sides of the oven. Extension Racks Always pull the rack out by its upper front rail to its fully open position, when placing or removing cookware. Extension racks cannot be used in the top rack position. ,IH[WHQVLRQUDFNVDUHGLIILFXOWWRH[WHQGOXEULFDWHWKH racks per the Care and Cleaning section of this manual. To Remove An Extension Rack: 1. Make sure the rack is pushed all the way into the oven so that side paddles on the rack disengage from the oven support. 6OLGHWKHUDFNWRZDUG\RXWRWKHEXPS VWRSSRVLWLRQ on the rack support. 3. Firmly grasp both sides of the rack frame and the sliding rack, tilt the front end up and pull it out. To Replace An Extension Rack: 1. Firmly grasp both sides of the rack frame and the sliding rack. 3ODFHWKHFXUYHGHQGRIWKHUDFN VWRSORFNV RQWR the oven supports, tilt up the front of the rack and push it in as far as it will go. ,IH[WHQVLRQUDFNVDUHGLIILFXOWWRUHSODFHRUUHPRYHSXW some vegetable oil on a soft cloth or paper towel and wipe the oven rack supports. Do not wipe oil on the rack slides. NOTE: 8VLQJRWKHUFRRNLQJRLOVOLNHSHDQXWRLO3DP or other lubricant sprays, can cause a discoloring or a rust like color residue on the racks and cavity sides. To clean this residue, use a soap and water or a vinegar and water solution. Rinse with clean water and dry with a soft cloth. 8SSHU)URQW Rail Fully Open Position Grasp here 3 1 Floor 49-2003957 Rev. 0 CAUTION Do not use any type of foil or oven liner to cover the oven bottom. These items can trap heat or melt, resulting in damage to the product and risk of shock, smoke or fire. Damage from improper use of these items is not covered by the product warranty. Foil may be used to catch spills by placing a sheet on a lower rack, several inches below the food. Do not use more IRLOWKDQQHFHVVDU\DQGQHYHUHQWLUHO\FRYHUDQRYHQUDFNZLWKDOXPLQXPIRLO.HHSIRLODWOHDVW´IURPRYHQZDOOV to prevent poor heat circulation. Aluminum Foil and Oven Liners Cookware Guidelines The material, finish, and size of cookware affect baking performance. Dark, coated and dull pans absorb heat more readily than light, shiny pans. Pans that absorb heat more readily can result in a browner, crisper, and thicker crust. ,IXVLQJGDUNDQGFRDWHGFRRNZDUHFKHFNIRRGHDUOLHU WKDQPLQLPXPFRRNWLPH,IXQGHVLUDEOHUHVXOWVDUH obtained with this type of cookware consider reducing RYHQWHPSHUDWXUHE\)QH[WWLPH Shiny pans can produce more evenly cooked baked goods such as cakes and cookies. Glass and ceramic pans heat slowly but retain heat well. These types of pans work well for dishes such as pies and custards. Air insulated pans heat slowly and can reduce bottom browning. .HHSFRRNZDUHFOHDQWRSURPRWHHYHQKHDWLQJ Cookware used in broil modes and air fry must be broil- safe. USING THE APPLIANCE: Aluminum Foil and Oven Liners / Cookware Guidelines 49-2003957 Rev. 0 13 USING THE APPLIANCE: Cooking Modes Cooking Modes Your new oven has a variety of cooking modes to help you get the best results. These modes are described below. Refer to the Cooking Guide section for recommendations for specific foods, and check out the cooking options menu on the appliance display for cooking tips and other recommendations while setting an oven mode. Remember, your new oven may perform differently than the oven it is replacing. Baking and Roasting Modes Select a mode for baking and roasting based on the type and quantity of food you are preparing. When preparing baked goods such as cakes, cookies, and pastries always preheat the oven first. Follow recipe UHFRPPHQGDWLRQVIRUIRRGSODFHPHQW,IQRJXLGHOLQHV are provided, center food in the oven. Bake The traditional bake mode is intended for single rack cooking. This mode uses heat primarily from the lower element but also from the upper element to cook food. To use this mode press Bake , enter a temperature, and then press Start . Preheating is generally recommended when using this mode. Convection Bake Multi Rack (on some models/ovens) 7KH&RQYHFWLRQ%DNH0XOWL5DFNPRGHLVLQWHQGHG for baking on multiple racks at the same time. This mode uses heat primarily from the rear element but also heat from the upper and lower elements, along with air movement from the convection fan to enhance cooking evenness. Your oven is equipped with Auto Recipe Conversion, so it is not necessary to convert the WHPSHUDWXUHZKHQXVLQJWKLVPRGH%DNLQJWLPHPLJKW be slightly longer for multiple racks than what would be expected for a single rack. To use this mode press Convection Bake Multi Rac k, enter a temperature, and then press Start . Always preheat when using this mode. Convection Roast (on some models/ovens) The Convection Roast mode is intended for roasting meats and vegetables on a single rack. This mode uses heat from the lower, upper, and rear elements along with air movement to improve browning and reduce cooking WLPH,WLVQRWQHFHVVDU\WRFRQYHUWWHPSHUDWXUH&KHFN food earlier than the recipe suggested time when using this mode, or use the probe. To use this mode press Convection Roast , enter a temperature, and then press Start ,WLVQRWQHFHVVDU\WRSUHKHDWZKHQXVLQJWKLV mode. Broiling Modes Always broil with the door closed. The broil element in this oven is very powerful. Monitor food closely ZKLOHEURLOLQJ8VHFDXWLRQZKHQEURLOLQJRQXSSHUUDFN positions as placing food closer to the broil element increases smoking, spattering, and the possibility of IDWVLJQLWLQJ%URLOLQJRQWKHWRSUDFNSRVLWLRQLVQRW recommended. 7U\EURLOLQJIRRGVWKDW\RXZRXOGQRUPDOO\JULOO$GMXVW UDFNSRVLWLRQVWRDGMXVWWKHLQWHQVLW\RIWKHKHDWWRWKH food. Place foods closer to the broil element when a seared surface and rare interior is desired. Thicker foods and foods that need to be cooked through should be broiled on a rack position farther from the broiler or by XVLQJ7UDGLWLRQDO%URLO/RRU&RQYHFWLRQ%URLO/R)RU best performance, center food below the broil heating element. Broil 7KH7UDGLWLRQDO%URLO+LJKPRGHXVHVLQWHQVHKHDWIURP WKHXSSHUHOHPHQWWRVHDUIRRGV8VH%URLO+LJKIRU thinner cuts of meat and/or foods you prefer less done on the interior. To use this mode press Broil , then select High or Low depending on the amount of searing and the internal temperature that is preferred, and then press Start ,WLVQRWQHFHVVDU\WRSUHKHDWZKHQXVLQJWKLV mode. 14 49-2003957 Rev. 0 Cooking Modes (Cont.) Air Fry (on some models/ovens) The Air Fry mode is a special, no-preheat convection cooking mode designed to produce foods with a crispier exterior than traditional oven cooking. The Air Fry mode is intended for single rack cooking only. Select Air Fry , then input the desired set temperature and press Start. 7KHWHPSHUDWXUHFDQEHVHWEHWZHHQ)DQG) Preheating is not recommended for this mode. Follow traditional oven recipe or package guidelines for set WHPSHUDWXUHVDQGFRRNWLPHVDGMXVWFRRNWLPHWRDFKLHYH your desired crispness. Additional guidelines for using this mode can be found in the Cooking Guide. Proof 3URRIPRGHLVGHVLJQHGIRUULVLQJ IHUPHQWLQJDQG proofing) bread doughs. Select Proof and then press Start. &RYHUGRXJKZHOOWRSUHYHQWGU\LQJRXW%UHDGZLOO rise more rapidly than at room temperature. Warm Warm mode is designed to keep hot foods hot for up to 3 hours. To use this mode, select Warm and then press Start. Cover foods that need to remain moist and do not cover foods that should be crisp. Preheating is not required. Do not use warm to heat cold food other WKDQFULVSLQJFUDFNHUVFKLSVRUGU\FHUHDO,WLVDOVR recommended that food not be kept warm for more than KRXUV Precision Cooking (on some models/ ovens) Precision Cooking is a guided cooking experience designed to give you the best outcome from your oven for specific foods. When you select a food through the Precision Cooking Menu, the recommended oven settings for that food are automatically selected and additional information is provided to help you get the best result. Additional cycles will be available through software updates. Connect your oven to have access to these updates. See the Wi-Fi Connect section for details on how to connect your oven. USING THE APPLIANCE: Cooking Modes 49-2003957 Rev. 0 15 USING THE APPLIANCE: Cooking Modes Cooking Modes Once you select a Traditional Cooking mode or Precision Cooking mode, Cooking Options will show up on the left part of the screen and information about selections will show up on the right side of the screen. 1. COOKING OPTIONS A cooking option will only be displayed if it is available RUUHTXLUHGIRUWKHFRRNLQJPRGHVHOHFWHG,IDFRRNLQJ option is not displayed for a selected cooking mode, then it is not available to use or is not required. Note that any cooking options displayed for a cooking mode will have default selections but confirm that the default settings and selections match your desired inputs VXFKDVVHWWHPSHUDWXUHFRRNWLPHVL]HRUW\SH DQG RXWFRPH GRQHQHVV 7KLVLVHVSHFLDOO\LPSRUWDQWZKHQ using Precision Cooking modes. Make sure to scroll up and down to view all the Cooking Options available for a selected cooking mode. Temperature When selecting an oven set temperature, preset temperatures are shown and can be selected by scrolling horizontally and selecting the desired temperature. The option to set a custom cooking temperature is available by using the number pad. Not all Precision Cooking modes require you to set a cooking temperature. Timer ,IWKHFRRNLQJPRGHVHOHFWHGVXSSRUWVDFRRNLQJWLPHU this option allows you to set a countdown cooking timer that can be set to turn off or not turn off the cooking mode when the timer is complete. Some Precision Cooking modes have a timer DXWRPDWLFDOO\VHWIRUWKHP,QWKHVHFDVHVWKH7LPHU RSWLRQGRHVQRWGLVSOD\,QVWHDGWKHWLPHUFRXQWGRZQ starts after Start is pressed. This timer will not turn off the oven when the timer is complete. Probe This option displays if the oven probe can be used with a Traditional oven mode. See the Probe section for details on using the oven probe. Some Precision Cooking modes require using the oven probe provided with the oven. For these cycles, probe placement instructions are provided but the probe set temperature is determined by the precision cooking mode selected. Cooking Mode Start 1:59 PM 1. Cooking Options 4XLFN6HWWLQJ Shade 1DYLJDWLRQ%DU 6WDWXV%DU Number Pad ,QIRUPDWLRQ or Selections 3. Setting a Cooking Mode From the Home Screen, select the oven when using a double oven. Then select the Traditional Cooking mode or Precision Cooking . ,I\RXVHOHFW3UHFLVLRQ&RRNLQJFDWHJRULHVZLOOVKRZXS on the left part of the screen and food options will show up on the right. 1. Categories: Food items are grouped into Categories. Scroll up and down to see all Categories. Select a Category to see all food options within a Category on the right side of the screen. Foods: Scroll left and right to see all food options within a Category. Select a food on the right side of the screen to begin cooking. Additional categories and food options will be available through software updates. Connect your oven to have access to these updates. See the Wi-Fi Connectivity section for details on how to connect your oven. 1. Categories )RRGV Precision Cooking 1:59 PM 16 49-2003957 Rev. 0 Cooking Modes (Cont.) USING THE APPLIANCE: Cooking Modes Setting a Cooking Mode (Cont.) 1. COOKING OPTIONS (cont.) Cooking Tips This option provides helpful information tailored to the cooking mode selected. This may include tips about how to prepare food for cooking, how cookware can impact cooking results, or how to help prevent messes in the oven cavity. Rack & Cookware For some Precision Cooking modes, this option gives rack location and cookware suggestions tailored to what mode is selected. Number of Racks )RUVRPH3UHFLVLRQ&RRNLQJPRGHV EDNHGJRRGVVXFK as Cookies for example), this provides cooking options IRUFRRNLQJRQRQHUDFNRUPXOWLSOHUDFNV,IWKLVRSWLRQ is not displayed, the expectation is that you are cooking on a single rack. Doneness )RUVRPH3UHFLVLRQ&RRNLQJPRGHV VXFKDVVWHDNV or bacon), this option requires you to choose a desired doneness for the food selected. Some Foods with Doneness options require the probe while others rely on cooking time. When a Doneness option is selected the probe target or cooking time, as well as the oven cooking conditions, update based on the food selection made. Size )RUVRPH3UHFLVLRQ&RRNLQJPRGHV VXFKDVVDOPRQ this option requires you to pick from a list of selections to tailor cooking conditions and cook time based on the selections made. Type )RUVRPH3UHFLVLRQ&RRNLQJPRGHV VXFKDVEDFRQ this option requires you to pick from a list of selections VXFKDVWKLFNUHJXODURUFHQWHUFXWIRUEDFRQ WR tailor cooking conditions and cook time based on the selections made. 2. INFORMATION OR SELECTIONS The content in this area varies according to the active option selected on the left. Make sure to swipe left and right in this area to see all the relevant content. There may be cookware recommendations or additional tips to reference. 3. START Review cooking option settings, your selections and SODFHRYHQUDFNV V EHIRUHSUHVVLQJ Start . 49-2003957 Rev. 0 17 Probe (on some models) ,QWHUQDOIRRGWHPSHUDWXUHLVIUHTXHQWO\XVHGDVDQLQGLFDWRURIGRQHQHVVHVSHFLDOO\IRUURDVWVDQGSRXOWU\7KH3UREH mode monitors the internal food temperature and turns the oven off when the internal food temperature reaches the programmed temperature. WARNING Consuming undercooked food can result in foodborne illness. Use probe according to the following instructions to ensure all portions of the food reach minimum safe cooking temperatures. Minimum safe food temperature recommendations are provided by the USDA and FDA. Always check the temperature at multiple locations in the food with a food thermometer after cooking to ensure that all portions of the food have reached the minimum safe internal temperature for that food. Proper Probe Placement After preparing the meat and placing it on the cooking pan follow these instructions for proper probe placement. Ŷ ,QVHUWWKHSUREHLQWRWKHIRRGVRWKDWWKHWLSRIWKH probe will rest in the center of the thickest part of the food. For best performance the probe should EHIXOO\LQVHUWHGLQWRWKHIRRG,IWKHSUREHLVQRW located properly, it may not accurately measure the temperature of the coolest portion of the food. Some foods, particularly small items, are not well suited for cooking with the probe due to their shape or size. Ŷ 7KHSUREHVKRXOGQRWWRXFKERQHIDWRUJULVWOH Ŷ )RUZKROHSRXOWU\LQVHUWWKHSUREHLQWRWKHWKLFNHVW part of the breast. Ŷ )RUERQHOHVVURDVWVLQVHUWWKHSUREHLQWRWKHFHQWHU of the roast. Ŷ )RUERQHLQKDPRUODPELQVHUWWKHSUREHLQWRWKH FHQWHURIWKHORZHVWODUJHPXVFOHRUMRLQW Ŷ )RUFDVVHUROHVRUGLVKHVVXFKDVPHDWORDILQVHUWWKH probe into the center of the dish. Ŷ )RUILVKLQVHUWWKHSUREHIURPMXVWDERYHWKHJLOOLQWR the meatiest area, parallel to the backbone. Probe Usage To use the probe ,QVHUWWKHSUREHLQWRWKHIRRG VHH3URSHU3UREH Placement). 3ODFHWKHIRRGLQWKHRYHQDQGFRQQHFWWKHSUREH LQWRWKHSUREHRXWOHWLQWKHRYHQ V NOTE: The probe cannot be used during broil, convection broil, dehydrate, warm, proof. 3. Select the desired cooking mode and temperature. ,IWKHFRRNLQJPRGHVXSSRUWVXVHZLWKDSUREHWKH probe setting screen will be displayed. Enter the desired internal food temperature and press Start . 7KHSUREHWHPSHUDWXUHFDQEHVHWEHWZHHQ)DQG ) NOTE: ,ISUHKHDWLQJLVGHVLUHGFRPSOHWHWKLVVWHS ahead of step 1. 7UDGLWLRQDOFRRNLQJPRGHV H[FOXGHV6ORZ5RDVW HQG the mode when the probe temperature is reached and Precision Cooking modes do not. Probe Care Guidelines NOTE: some double oven models have a probe in the upper oven only. Ŷ 8VHRISUREHVRWKHUWKDQWKHRQHSURYLGHGZLWKWKLV product may result in damage to the probe. Ŷ 8VHWKHKDQGOHVRIWKHSUREHDQGSOXJZKHQLQVHUWLQJ and removing them from the meat and outlet. Ŷ 7RDYRLGGDPDJLQJ\RXUSUREHGRQRWXVHWRQJVWR pull on the cable when removing it. Ŷ 7RDYRLGEUHDNLQJWKHSUREHPDNHVXUHIRRGLV completely defrosted before inserting the probe. Ŷ 7RSUHYHQWSRVVLEOHEXUQVGRQRWXQSOXJWKHSUREH from the outlet until the oven has cooled. Ŷ 1HYHUOHDYHWKHSUREHLQVLGHWKHRYHQGXULQJDVHOIRU steam clean cycle. Ŷ 'RQRWVWRUHWKHSUREHLQWKHRYHQ USING THE APPLIANCE: Probe 18 49-2003957 Rev. 0 Cooking Guide - Upper Oven The table below provides some guidelines for typical cooking modes. FOOD TYPE RECOMMENDED MODE(S) RECOMMENDED RACK POSITION(S) ADDITIONAL SUGGESTIONS Baked Goods Layer cakes, sheet cakes, bundt cakes, muffins 7UDGLWLRQDO%DNH 1 8VHVKLQ\FRRNZDUH Cookies, biscuits, scones 7UDGLWLRQDO%DNH 1 8VHVKLQ\FRRNZDUH Beef & Pork Hamburgers %URLO+L 1 8VHDEURLOSDQPRYHIRRGGRZQIRUPRUHGRQHQHVVOHVVVHDULQJ Watch food closely when broiling. For best performance, center food below the broil heating element. Steaks & Chops %URLO+L 1 8VHDEURLOSDQPRYHIRRGGRZQIRUPRUHGRQHQHVVOHVVVHDULQJ Watch food closely when broiling. For best performance, center food below the broil heating element. Poultry %RQHLQFKLFNHQEUHDVWVOHJV thighs 7UDGLWLRQDO%DNH %URLO/R 1 Watch food closely when broiling. For best performance, center food below the broil heating element. %RQHOHVVFKLFNHQEUHDVWV 7UDGLWLRQDO%DNH %URLO/R 1 Watch food closely when broiling. For best performance, center food below the broil heating element. Fish %URLO/R 1 Watch food closely when broiling. For best performance, center food below the broil heating element. Casseroles 7UDGLWLRQDO%DNH 1 Frozen Convenience Foods Pizza 7UDGLWLRQDO%DNH 1 8VHVKLQ\FRRNZDUH Potato products, chicken nuggets, appetizers 7UDGLWLRQDO%DNH 1 8VHVKLQ\FRRNZDUHZKHQXVLQJWUDGLWLRQDOEDNH 0LQLPXPVDIHIRRGWHPSHUDWXUHUHFRPPHQGDWLRQVDUHSURYLGHGE\WKH86'$DQG)'$8VHDIRRGWKHUPRPHWHUWR take food temperatures and check several locations. USING THE APPLIANCE: &RRNLQJ*XLGH8SSHU2YHQ 49-2003957 Rev. 0 FOOD TYPE RECOMMENDED MODE(S) RECOMMENDED RACK POSITION(S) ADDITIONAL SUGGESTIONS Baked Goods Layer cakes, sheet cakes, bundt cakes, muffins, quick breads on a Single Rack 7UDGLWLRQDO%DNH 1 8VHVKLQ\FRRNZDUH Layer cakes* on Multiple Racks &RQYHFWLRQ%DNH0XOWL )ORRUDQGH[W (QVXUHDGHTXDWHDLUIORZ VHHLOOXVWUDWLRQEHORZ &KLIIRQFDNHV DQJHOIRRG 7UDGLWLRQDO%DNH Floor 8VHVKLQ\FRRNZDUH Cookies, biscuits, scones on a Single Rack 7UDGLWLRQDO%DNH 1 8VHVKLQ\FRRNZDUH Cookies, biscuits, scones on Multiple Racks &RQYHFWLRQ%DNH0XOWL )ORRUDQGH[W Ensure adequate airflow. Beef & Pork Hamburgers %URLO+L 8VHDEURLOSDQPRYHIRRGGRZQIRUPRUHGRQHQHVVOHVVVHDULQJ Watch food closely when broiling. For best performance, center food below the broil heating element. Steaks & Chops %URLO+L 8VHDEURLOSDQPRYHIRRGGRZQIRUPRUHGRQHQHVVOHVVVHDULQJ Watch food closely when broiling. For best performance, center food below the broil heating element. Roasts 7UDGLWLRQDO%DNH Convection Roast Floor or 1 ext Leave uncovered, use a low sided pan such as a broil pan. Preheating is not necessary. Poultry Whole chicken 7UDGLWLRQDO%DNH Convection Roast Floor or 1 ext 8VHDORZVLGHGSDQVXFKDVDEURLOSDQ Preheating is not necessary. %RQHLQFKLFNHQEUHDVWVOHJV thighs %URLO/R 7UDGLWLRQDO%DNH Convection Roast 1 %URLOVNLQVLGHGRZQILUVW:DWFKIRRGFORVHO\ZKHQEURLOLQJ)RU best performance when broiling, center food below the broil heating element. %RQHOHVVFKLFNHQEUHDVWV %URLO/R 7UDGLWLRQDO%DNH Convection Roast 1 Move food down for more doneness/less searing and up for greater searing/browning when broiling. For best performance when broiling, center food below the broil heating element. Whole turkey 7UDGLWLRQDO%DNH Convection Roast Floor 8VHDORZVLGHGSDQVXFKDVDEURLOSDQ Preheating is not necessary. 7XUNH\%UHDVW 7UDGLWLRQDO%DNH Convection Roast Floor or 1 ext 8VHDORZVLGHGSDQVXFKDVDEURLOSDQ Preheating is not necessary. Fish %URLO/R RU Watch food closely when broiling. For best performance, center food below the broil heating element. Casseroles 7UDGLWLRQDO%DNH 1 Frozen Convenience Foods Pizza on a single rack 7UDGLWLRQDO%DNH 1 8VHVKLQ\FRRNZDUH Pizza on multiple racks &RQYHFWLRQ%DNH0XOWL )ORRUDQGH[W 8VHVKLQ\FRRNZDUH Potato products, chicken nuggets, appetizers on single racks 7UDGLWLRQDO%DNH 1 8VHVKLQ\FRRNZDUHZKHQXVLQJWUDGLWLRQDOEDNH Potato products, chicken nuggets, appetizers on multiple racks &RQYHFWLRQ%DNH0XOWL )ORRUDQGH[W 8VHVKLQ\FRRNZDUH6ZLWFKIRRGORFDWLRQSDUWLDOO\WKURXJK cooking for more even cooking results. Minimum safe food temperature recommendations DUHSURYLGHGE\WKH86'$DQG)'$8VHDIRRG thermometer to take food temperatures and check several locations. When baking four cake layers at a time, use the floor UDFNDQGWKHH[WHQVLRQUDFNRQLQWKHORZHUFDYLW\ Center the pans front to back on racks as shown. The table below provides some guidelines for typical cooking modes. Cooking Guide - Lower Oven Floor Rack USING THE APPLIANCE: Cooking Guide - Lower Oven 49-2003957 Rev. 0 Cooking Guide AIR FRY COOKING GUIDE Air Fry is a special, no-preheat, cooking mode that is designed to produce foods with a crispier exterior than traditional oven cooking. Select Air Fry , then input the desired set temperature and press Start . The WHPSHUDWXUH FDQ EH VHW EHWZHHQ ) DQG ) Air Fry Cookware Guidelines • Only use broil safe cookware when using Air Fry mode. • A dark sheet pan is recommended. A dark pan promotes better browning and crisping. • Oven baking baskets and baking grids can also be used. A sheet pan should be placed on the rack below the foods to catch any drippings when using a baking basket. General Tips for Air Fry Mode • The Air Fry mode is designed for cooking on a single rack. • The Air Fry mode is designed to be used without preheating. 5DFN SRVLWLRQ LV UHFRPPHQGHG IRU PRVW IRRGV,I foods are browning too rapidly try using a lower rack position. • Foods may cook faster than expected if the oven is already hot when food is placed in the oven. • When air frying foods with sauce, it is recommended to apply the sauce at the end of cooking. ,I IRRGV DUH EURZQLQJ WRR TXLFNO\ WU\ D ORZHU UDFN position or lower oven set temperature. • For packaged foods, use traditional oven cooking instructions for set temperature and expected cook time. ,W LV QRW QHFHVVDU\ WR IOLS RU VWLU IRRG GXULQJ FRRNLQJ • Arrange food in a single layer on the pan, do not overload the pan. For best results food should not overlap. • Cook food thoroughly to help protect against foodborne illness. Minimum safe food temperature UHFRPPHQGDWLRQV DUH SURYLGHG E\ WKH 86'$ DQG )'$ 8VH D IRRG WKHUPRPHWHU WR WDNH IRRG WHPSHUDWXUHV DQG check several locations. FOOD TYPE RECOMMENDED RACK POSITION(S) RECOMMENDED SET TEMPERATURES (F ) RECOMMENDED COOK TIME (MIN) NOTES Fresh boneless fish or poultry pieces, breaded such as nuggets, tenders, fillets H[WHQVLRQ 375-400 15-30 8VHU ORZHU VHW WHPSHUDWXUHV IRU ODUJHU SLHFHV 8VH VKLQ\ FRRNZDUH Fresh bone in chicken wings H[WHQVLRQ 375-400 Salt wings or coat in a dry rub, if using sauce apply after cooking or toward the end of cooking Fresh bone in chicken drumsticks or thighs H[WHQVLRQ 375-400 30-55 8VHU ORZHU VHW WHPSHUDWXUHV IRU ODUJHU SLHFHV Fresh French fries, WKLQ ò LQFK H[WHQVLRQ 15-30 Parchment paper is recommended when preparing fresh French fries. For crispier fries, toss fries in corn starch or rice flour before cooking. Fresh French fries, WKLFN ! ò LQFK H[WHQVLRQ 375-400 Parchment paper is recommended when preparing fresh French fries. For crispier fries, toss fries in corn starch or rice flour before cooking. Frozen packaged foods H[WHQVLRQ 8VH WUDGLWLRQDO RYHQ QRW $LU )U\ FRRNLQJ LQVWUXFWLRQV DV D JXLGHOLQH IRU VHW WHPSHUDWXUH DQG FRRN WLPH$GGLWLRQDO FRRN WLPH EH\RQG UHFRPPHQGHG SDFNDJH WLPH PD\ EH UHTXLUHG IRU VRPH IRRGV ,I RYHQ LV KRW ZKHQ VWDUWLQJ IRRG may cook faster than the minimum package time. Primary recommended cookware Alternate cookware options USING THE APPLIANCE: Air Fry Cooking Guide 49-2003957 Rev. 0 %HVXUHHOHFWULFDOSRZHULVRIIDQGDOOVXUIDFHVDUHFRROEHIRUHFOHDQLQJDQ\SDUWRIWKHUDQJH Control Panel 7RORFNWKHFRQWUROVUHIHUHQFHWKH4XLFN6HWWLQJVVKDGHLQIRUPDWLRQLQWKH$SSOLDQFH'LVSOD\6HWWLQJVVHFWLRQ,W¶VD good idea to wipe the control panel after each use. Clean with mild soap and water or vinegar and water, rinse with clean water and polish dry with a soft cloth. Do not use abrasive cleansers, strong liquid cleansers, plastic scouring SDGVRURYHQFOHDQHUVRQWKHFRQWUROSDQHO²WKH\ZLOOGDPDJHWKHILQLVK Oven Exterior Do not use oven cleaners, abrasive cleansers, strong liquid cleansers, steel wool, plastic scouring pads, or cleaning powders on the exterior of the oven. Clean with a mild soap and water or vinegar and water solution. Rinse with clean water and dry with a soft cloth. When cleaning surfaces, make sure that they are at room temperature and not in direct sunlight. ,IVWDLQRQWKHGRRUYHQWWULPLVSHUVLVWHQWXVHDPLOG abrasive cleaner and a sponge-scrubber for best results. 6SLOODJHRIPDULQDGHVIUXLWMXLFHVWRPDWRVDXFHVDQG basting liquids containing acids may cause discoloration and should be wiped up immediately. Let hot surfaces cool, then clean and rinse. Cleaning The Oven - Exterior Painted Surfaces and Black Stainless Steel (on some models) Painted surfaces may include the door and trim around the control panel. Clean these with soap and water or a vinegar and water solution. Do not use commercial oven cleaners, cleaning powders, steel wool or harsh abrasives on any painted VXUIDFHLQFOXGLQJ%ODFN6WDLQOHVV6WHHO Stainless Steel - Excluding Black Stainless Steel (on some models) Do not use a steel wool pad; it will scratch the surface. To clean the stainless steel surface, use warm sudsy water or a stainless steel cleaner or polish. Always wipe the surface in the direction of the grain. Follow the cleaner instructions for cleaning the stainless steel surface. Cleaners with oxalic acid will remove surface rust, tarnish DQGVPDOOEOHPLVKHV8VHRQO\DOLTXLGFOHDQVHUIUHHRIJULW and rub in the direction of the brush lines with a damp, soft sponge. To inquire about purchasing cleaning products including stainless steel appliance cleaner or polish, see the Accessories and Consumer Support sections at the end of this manual. USING THE APPLIANCE: Cleaning the Oven -Exterior 49-2003957 Rev. 0 Cleaning The Oven - Interior The interior of your new oven can be cleaned manually or by using Steam Clean or Self Clean modes. 6SLOODJHRIPDULQDGHVIUXLWMXLFHVWRPDWRVDXFHVDQGEDVWLQJOLTXLGVFRQWDLQLQJDFLGVPD\FDXVHGLVFRORUDWLRQDQG should be wiped up immediately. Let hot surfaces cool, then clean and rinse. Manual Cleaning 'RQRWXVHRYHQFOHDQHUV XQOHVVFHUWLILHGIRUVHOIFOHDQLQJRYHQ VWURQJOLTXLGFOHDQVHUVRUVFRXULQJSDGVRQWKH interior of the oven. Clean with a mild soap and water, or vinegar and water solution. Rinse with clean water and dry with a soft cloth. When cleaning surfaces, make sure that they are at room temperature. Steam Clean Mode Steam Clean is designed to sufficiently heat the water added to the bottom, allowing in to reach a temperature that causes steam to condense on food soils. This process softens the residues, making them easier to remove. The oven should be cool before beginning a Steam Clean cycle. This allows for safe wiping of grease and soils form the oven bottom beforehand. Additionally, it prevents the risk of thermal shock and enamel cracking that could result from pouring cold water onto the hot oven surface. Pour one cup of water into the bottom of the oven. Close the door. Select Steam Clean and press Start to the right of the screen. You should not open the door during the 30-minute steam clean as this will decrease the steam clean performance. Wipe out any excess water and any remaining soil. NOTE: Water in the bottom of the oven may be hot right after finishing the cycle. Self Clean Mode 5HDG6HOI&OHDQLQJ2YHQ6DIHW\,QVWUXFWLRQVDWWKH beginning of this manual before using Self Clean Mode. Self clean uses very high temperatures to clean the oven interior. The oven door will lock when using this feature. %HIRUHRSHUDWLQJWKHVHOIFOHDQF\FOHZLSHXSJUHDVH and soils from the oven. Remove all items from the oven RWKHUWKDQHQDPHOHG GDUNFRORU UDFNV6KLQ\RUVLOYHU racks, the meat probe, and any cookware or other items should all be removed from the oven before initiating a VHOIFOHDQF\FOH&ORVHWKHGRRU,IXVLQJDGRXEOHRYHQ select which oven you would like to clean. Select Self Clean . Choose a 3, 4, or 5 hour cycle, and select Start . For heavily soiled ovens, the maximum 5 hour clean time LVUHFRPPHQGHG,I\RXZLVKWRXVHWKHGHIDXOWWLPHSUHVV Start immediately after selecting Self Clean . The oven will show that the door has locked and display the amount of time remaining in the cycle. Press Cancel if you wish to stop the cycle. The oven will turn off automatically when the self clean cycle is complete. The door will stay locked until the oven has cooled down. After the oven has cooled down wipe any ash out of the oven. We recommend venting your kitchen with an open window or using a ventilation fan or hood during the first self-clean cycle. Soil on the front frame of the oven and outside the gasket on the door will need to be cleaned by hand. Clean these areas with hot water, soap-filled steel wool pads or cleaners such as Soft Scrub . Rinse well with clean water and dry. Do not clean the gasket. The fiberglass material of WKHRYHQGRRUJDVNHWFDQQRWZLWKVWDQGDEUDVLRQ,WLV HVVHQWLDOIRUWKHJDVNHWWRUHPDLQLQWDFW,I\RXQRWLFHLW becoming worn or frayed, replace it. Make sure the oven light bulb cover is in place and the oven light is off. When using the Self Clean Mode in a double oven, only the upper or lower oven can utilize the cycle at one time. Additionally, no other mode may be started in the alternate oven cavity while self clean is in progress. IMPORTANT: The health of some birds is extremely sensitive to the fumes given off during the self-cleaning cycle of any range. Move birds to another well-ventilated room. USING THE APPLIANCE: &OHDQLQJWKH2YHQ,QWHULRU 49-2003957 Rev. 0 Cleaning The Oven - Interior Probe The temperature probe may be cleaned with soap and water or a soap-filled scouring pad. Cool the temperature probe before cleaning. Scour stubborn spots with a soap- filled scouring pad, rinse and dry. To order additional temperature probes see the Accessories and Consumer Support sections at the end of this manual. Ŷ Do not immerse the temperature probe in water. Ŷ Do not store the temperature probe in the oven. Ŷ Do not leave the temperature probe inside the oven during a self or steam clean cycle. Oven Racks ,IWKHUDFNVWKDWZHUHSURYLGHGZLWK\RXURYHQDUHGDUN enameled racks, not shiny, they may remain in the oven during the self-cleaning cycle without being damaged. To manually clean racks, use warm, soapy water. Make sure not to wash the rack slides on an extension rack. ,IUDFNVEHFRPHPRUHGLIILFXOWWRUHPRYHIURPWKHRYHQ put some vegetable oil on a soft cloth or paper towel and rub onto the oven rack supports. Do not wipe the oil on an extension rack slide. NOTE: 8VLQJRWKHUFRRNLQJRLOVOLNHSHDQXWRLO3DP or other lubricant sprays, can cause a discoloring or a rust like color residue on the racks and cavity sides. To clean this residue, use a soap and water or a vinegar and water solution. Rinse with clean water and dry with a soft cloth. Periodically, the oven racks may need to be lubricated using the lubricant shipped with your oven. To order additional lubricant, see accessories section of this manual. Using the oven: 1. Remove rack from the oven. See the Extension Oven Racks section. )XOO\H[WHQGWKHUDFNRQDWDEOHRUFRXQWHUWRS Newspaper may be placed underneath the rack for easy cleanup. ,IWKHUHLVGHEULVLQWKHVOLGHWUDFNVZLSHLWDZD\XVLQJ a paper towel. NOTE: Any lubricant wiped away must be replaced. 4. Shake the lubricant before opening it. Starting with OHIWVOLGHPHFKDQLVPRIWKHUDFNSODFHIRXU VPDOO GURSVRIOXEULFDQWRQWKHWZR ERWWRPWUDFNVRIWKH slide close to the bearing carriers. 5. Repeat for the right slide mechanism of the rack. 6. Open and close the rack several times to distribute the lubricant. 7. Replace the cap on the lubricant and shake it again. Turn the rack over and repeat steps 3, 4, 5 and 6. )RUUDFNVXSSRUWVPROGHGLQWRWKHRYHQFDYLW\ZDOO only.) Also, for optimal sliding performance be sure to add a couple of drops of lubricant on the bracket and paddle VSULQJVKRZQEHORZ 8. Close the rack, turn rack right-side-up and place in the oven. See the Extension Oven Racks section. 5HSHDWDERYHVWHSVIRUHDFKUDFN Rack right- side-up Right side Left side Rack right-side-up KWWSVSURGXFWVJHDSSOLDQFHV com/appliance/gea-support- VHDUFKFRQWHQW"FRQWHQW,G %UDFNHW Paddle Spring USING THE APPLIANCE: &OHDQLQJWKH2YHQ,QWHULRU 49-2003957 Rev. 0 WARNING SHOCK OR BURN HAZARD: %HIRUHUHSODFLQJRYHQOLJKWEXOEGLVFRQQHFWWKHHOHFWULFDOSRZHUWRWKH oven at the main fuse or circuit breaker panel. Failure to do so may result in electric shock or burn. CAUTION BURN HAZARD: The glass cover and bulb should be removed when cool. Touching hot glass with bare hands or a damp cloth can cause burns. Oven Light 1. Disconnect power at the main fuse or circuit breaker panel. 5HPRYHRYHQUDFNV 3. Slide a flat blade screwdriver or butter knife between the metal housing and the glass light cover. NOTE: on some models there is a metal clip visibly holding the glass. The tool needs inserted between the metal housing and the clip holding the glass. 4. Support the glass light cover with two fingers to prevent the cover from falling to the bottom of the oven. 5. Gently twist the screwdriver blade or butter knife to ORRVHQWKHJODVVOLJKWFRYHU%HFDUHIXOQRWWRFKLS the oven coating. 6. Remove the glass light cover. 7. Remove the bulb by firmly grasping and sliding the bulb straight out until the two prongs have cleared the ceramic holder. 8. Do not touch the glass of the new replacement bulb ZLWK\RXUILQJHUV,WZLOOFDXVHWKHEXOEWRIDLOZKHQLW lights. Grasp the replacement bulb with a clean towel or facial tissue with the prongs facing down. Align the two prongs in the ceramic holder, pressing gently until the bulb is securely in the ceramic socket. 6OLGHWKHSURWHFWLYHOHQVLQWRWKHKROGHUDQGSXVK until the clips snap into the housing. 10. Reconnect power. CARE AND CLEANING: Oven Light 49-2003957 Rev. 0 Oven Door CARE AND CLEANING: Oven Door Lower Oven Door Removal NOTE: Door removal is not a requirement for installation of the product but is an added convenience. To remove the door: 1. Open the oven door as far as it will go. 5HPRYHKLQJHEUDFNHW LISUHVHQW IURPIURQWIUDPH and set aside. The hinge bracket must be replaced for proper door functionality when door is reinstalled. 3. Push both hinge locks down toward the door frame to the unlocked position. This may require a flat-blade screwdriver. DO NOT LIFT THE DOOR BY THE HANDLE! 4. Place hands on both sides of the door and close the RYHQGRRUWRWKHUHPRYDOSRVLWLRQ DSSUR[LPDWHO\ ´±´>FP±FP@IURPWKHFORVHGSRVLWLRQ 5. Lift the door up and out until the hinge arms clear the slots. NOTE: 7KHRYHQGRRULVYHU\KHDY\%HVXUH you have a firm grip before lifting the oven door off WKHKLQJHV8VHFDXWLRQRQFHWKHGRRULVUHPRYHG Do not lay the door on its handle. This could cause dents or scratches. Replacing the Lower Oven Door NOTE: The oven door is heavy. You may need help lifting the door high enough to slide it into the hinge slots. Do not lift the door by the handle. 1. Lift the oven door by grasping each side. :LWKWKHGRRUDWWKHVDPHDQJOHDVWKHUHPRYDO SRVLWLRQ DSSUR[LPDWHO\´±´>FP±FP@IURP the closed position), seat the notch of the hinge arm into the bottom edge of the hinge slot. The notch of the hinge arm must be fully seated into the bottom of the slot. )XOO\RSHQWKHGRRU,IWKHGRRUZLOOQRWIXOO\RSHQWKH indentation is not seated correctly in the bottom edge of the slot. 4. Push the hinge locks up against the front frame of the oven cavity, to the locked position. 5HSODFHKLQJHEUDFNHW LISUHVHQW 7KHKLQJHEUDFNHW must be replaced for proper door functionality. 6. Close the oven door. Hinge in Locked Position Notch of Hinge Securely Fitted ,QWR%RWWRPRI Hinge Slot %RWWRP Edge of Slot Hinge Arm Hinge Notch +LQJH%UDFNHW Hinge Slot Hinge Arm +LQJH8QORFNHG Position Hinge Clears Slot +LQJH%UDFNHW 49-2003957 Rev. 0 Save time and money! Review the charts on the following pages before you call for service. Check out self-help YLGHRVDQG)$4DW bodewell.com/faqs. Problem Possible Cause What To Do My new oven doesn't cook like my old one. Is something wrong with the temperature settings? Your new oven has a different cooking system from your old oven and therefore may cook differently than your old oven. For the first few uses, follow your recipe times DQGWHPSHUDWXUHVFDUHIXOO\,I\RXVWLOOWKLQN\RXU QHZRYHQLVWRRKRWRUWRRFROG\RXFDQDGMXVWWKH temperature yourself to meet your specific cooking preference. See the Special Features Section to DGMXVWWKHRYHQWHPSHUDWXUH NOTE: 7KLVDGMXVWPHQW DIIHFWV7UDGLWLRQDO%DNH&RQYHFWLRQ%DNHDQG &RQYHFWLRQ%DNH0XOWLWHPSHUDWXUHVLWZLOOQRWDIIHFW &RQYHFWLRQ5RDVW7UDGLWLRQDO%URLO&RQYHFWLRQ%URLO or Clean. Food does not bake properly Oven controls improperly set. See the Cooking Modes section. Rack position is incorrect or rack is not level. See the Cooking Modes section and Cooking Guide. ,QFRUUHFWFRRNZDUHRUFRRNZDUHRILPSURSHUVL]H being used. See the Cookware section. 2YHQWHPSHUDWXUHQHHGVDGMXVWPHQW See the Cooking option under the Settings section. ,QJUHGLHQWVXEVWLWXWLRQ Substituting ingredients can change the recipe outcome. Food does not broil properly Oven controls improperly set. Make sure you select the appropriate broil mode. ,PSURSHUUDFNSRVLWLRQEHLQJXVHG See the Cooking Guide for rack location suggestions. Food being cooked in a hot pan. Make sure cookware is cool Cookware not suited for broiling. 8VHDSDQVSHFLILFDOO\GHVLJQHGIRUEURLOLQJ Aluminum foil used on the broiling pan and grid has not been fitted properly and slit as recommended. ,IXVLQJDOXPLQXPIRLOFRQIRUPWRSDQVOLWV ,QVRPHDUHDVWKHSRZHU YROWDJH PD\EHORZ Preheat the broil element for 10 minutes. Oven temperature too hot or too cold 2YHQWHPSHUDWXUHQHHGVDGMXVWPHQW See the Cooking option under the Settings section. Oven does not work or appears not to work A fuse in your home may be blown or the circuit breaker tripped. Replace the fuse or reset the circuit breaker. Oven controls improperly set. 6HHWKH8VLQJWKH$SSOLDQFHDQG6HWWLQJD&RRNLQJ Mode sections. Oven is in Sabbath Mode Verify, that the oven is not in Sabbath Mode. See the Sabbath option under the Settings section. “Crackling” or “popping” sound This is the sound of the metal heating and cooling during both the cooking and cleaning functions. This is normal. Why is my range making a "clicking" noise when using my oven? Your range has been designed to maintain a tighter control over your oven's temperature. You may hear your oven's heating elements "click" on and off more frequently than in older ovens to achieve better results during cooking and cleaning cycles. This is normal. Clock and timer do not work A fuse in your home may be blown or the circuit breaker tripped. Replace the fuse or reset the circuit breaker. Oven light does not work Light bulb is loose or defective. Tighten or replace bulb. Oven will not self-clean The temperature is too high to set a self-clean operation. Allow the oven to cool and reset the controls. Oven controls improperly set. See the Cleaning the Oven section. Excessive smoking during clean cycle Excessive soil or grease. Press Cancel to stop the cycle. Open the windows to rid the room of smoke. Wait until the door unlocks. Wipe up the excess soil and reset the clean cycle. Troubleshooting tips ... %HIRUH\RXFDOOIRUVHUYLFH TROUBLESHOOTING TIPS 49-2003957 Rev. 0 TROUBLESHOOTING TIPS Problem Possible Cause What To Do Excessive smoking during broiling Food too close to burner element. Lower the rack position of the food. Oven door will not open after a clean cycle Oven too hot. Allow the oven to cool below locking temperature. Oven not clean after a clean cycle Oven controls improperly set. See the Cleaning the Oven section. Oven was heavily soiled. Clean up heavy spillovers before starting the clean cycle. Heavily soiled ovens may need to self-clean again or for a longer period of time. “F— and a number or letter” are displayed on LCD screen You have a function error code. Press Dismiss on the LCD screen. Allow the oven to cool for one hour. Put the oven back into operation. ,IWKHIXQFWLRQFRGHUHSHDWV Disconnect all power to the oven for at least 30 seconds DQGWKHQUHFRQQHFWSRZHU,IWKHIXQFWLRQHUURUFRGH repeats, call for service. LCD is not functioning properly A fuse in your home may be blown or the circuit breaker tripped. Replace the fuse or reset the circuit breaker. Oven controls improperly set. See the Cooking Modes or Settings section to ensure proper use. Ensure unit is updated to the most recent software update. LCD screen is locked. 8QORFNWKHVFUHHQE\SUHVVLQJWKH Unlock LFRQ,IWKLV does not correct the issue, cycle power at the circuit breaker and ensure unit is updated to the most recent software update. Touch Screen is not responding properly. Place your entire hand on the touch screen for 5 seconds then remove it to reset the touch screen sensitivity. LCD is faulty. Cycle power at the circuit breaker and ensure unit is XSGDWHGWRWKHPRVWUHFHQWVRIWZDUHXSGDWH,ILVVXH persists, call service to assess the issue. Power outage, clock resets Power outage or surge 5HVHWWKHFORFN,IWKHRYHQZDVLQXVH\RXPXVWUHVHW it by pressing Cancel , setting the clock and resetting any cooking function. “Burning” or “oily” odor emitting from the vent This is normal in a new oven and will disappear in time. To speed the process, set a self-clean cycle for a minimum of 3 hours. See the Cleaning the Oven section. Strong odor An odor from the insulation around the inside of the oven is normal for the first few times the oven is used. This is temporary and will go away after several uses or a self-clean cycle. Fan noise A cooling fan may automatically turn on. This is normal. The cooling fan will turn on to cool LQWHUQDOSDUWV,WPD\UXQIRUXSWRKRXUVDIWHUWKH oven is turned off. My oven door glass appears to be "tinted" or have a "rainbow" color. Is this defective? No. The inner oven glass is coated with a heat barrier to reflect the heat back into the oven to prevent heat loss and keep the outer door cool while baking. 7KLVLVQRUPDO8QGHUFHUWDLQOLJKWRUDQJOHV\RXPD\ see this tint or rainbow color. Sometimes the oven takes longer to preheat to the same temperature Cookware or food in oven The cookware or food in the oven will cause the oven to take longer to preheat. Remove items to reduce preheat time. Number of racks in oven Adding more racks to the oven will cause the oven to take longer to preheat. Remove some racks. Different cooking modes The different cooking modes use different preheat methods to heat the oven for the specific cooking PRGH6RPHPRGHVZLOOWDNHORQJHUWKDQRWKHUV LH convection bake multi). Oven will not work remotely Router issues, no wireless signal, etc. For assistance with oven wireless network connectivity, SOHDVHFDOO Oven is not connected. Troubleshooting tips ... %HIRUH\RXFDOOIRUVHUYLFH 49-2003957 Rev. 0 Staple your receipt here. Proof of the original purchase date is needed to obtain service under the warranty. LIMITED WARRANTY All warranty service for your appliance is provided exclusively by GE Appliances, a Haier company’s Factory Service Centers, or by a VHUYLFHWHFKQLFLDQDXWKRUL]HGE\*($SSOLDQFHVWRSURYLGHZDUUDQW\VHUYLFHIRU\RXUDSSOLDQFH7RVFKHGXOHVHUYLFHZLWKLQWKH86$YLVLW us at Bodewell.com/schedule-repair-service RUFDOO%2'(:(// ,Q&DQDGDYLVLW GEAppliances.ca, monogram.ca, or call 800.561.3344 . Please have your serial number and your model number available when calling for service. Service that has not been scheduled or otherwise arranged for by GE Appliances will not be covered under this warranty, including any parts and/or services provided. Servicing your appliance may require the use of the onboard data port for diagnostics. This gives a GE Appliances factory service technician the ability to quickly diagnose any issues with your appliance and helps GE Appliances improve its products by providing GE $SSOLDQFHVZLWKLQIRUPDWLRQRQ\RXUDSSOLDQFH,I\RXGRQRWZDQW\RXUDSSOLDQFHGDWDWREHVHQWWR*($SSOLDQFHVSOHDVHDGYLVH\RXU technician not to submit the data to GE Appliances at the time of service. What GE Appliances will not cover: Ŷ Service trips to your home to teach you how to use the product. Ŷ ,PSURSHULQVWDOODWLRQGHOLYHU\RUPDLQWHQDQFH Ŷ )DLOXUHRIWKHSURGXFWLILWLVDEXVHGPLVXVHGPRGLILHG or used for other than the intended purpose or used commercially. Ŷ 5HSODFHPHQWRIKRXVHIXVHVRUUHVHWWLQJRIFLUFXLWEUHDNHUV Ŷ 'DPDJHWRWKHSURGXFWFDXVHGE\DFFLGHQWILUHIORRGVRU acts of God. Ŷ ,QFLGHQWDORUFRQVHTXHQWLDOGDPDJHFDXVHGE\SRVVLEOH defects with this appliance. Ŷ 'DPDJHFDXVHGDIWHUGHOLYHU\ Ŷ 3URGXFWQRWDFFHVVLEOHWRSURYLGHUHTXLUHGVHUYLFH Ŷ 6HUYLFHWRUHSDLURUUHSODFHOLJKWEXOEVH[FHSWIRU LED lamps. Ŷ 'DPDJHWRILQLVKVXFKDVVXUIDFHUXVWWDUQLVKRUVPDOO blemishes not reported within 48 hours of delivery. Wall Oven Limited Warranty EXCLUSION OF IMPLIED WARRANTIES Your sole and exclusive remedy is product repair as provided in this Limited Warranty. Any implied warranties, including the implied warranties of merchantability or fitness for a particular purpose, are limited to one year or the shortest period allowed by law. For the period of GE Appliances will replace One year From the date of the original purchase Any part of the oven which fails due to a defect in materials or workmanship. During this limited one- year warranty , GE Appliances will provide, free of charge , all labor and in-home service to replace the defective part. Two years From the date of the original purchase of any Monogram brand oven Any part of the oven which fails due to a defect in materials or workmanship. During this limited two- year warranty , GE Appliances will provide, free of charge , all labor and in-home service to replace the defective part. For US Customers: This limited warranty is extended to the original purchaser and any succeeding owner for products SXUFKDVHGIRUKRPHXVHZLWKLQWKH86$,IWKHSURGXFW is located in an area where service by a GE Appliances Authorized Servicer is not available, you may be responsible for a trip charge or you may be required to bring the product to DQ$XWKRUL]HG*($SSOLDQFHV6HUYLFHORFDWLRQIRUVHUYLFH,Q Alaska, the limited warranty excludes the cost of shipping or service calls to your home. Some states do not allow the exclusion or limitation of incidental or consequential damages. This limited warranty gives you specific legal rights, and you may also have other rights which vary from state to state. To know what your legal rights are, consult your local or state consumer affairs office or your state’s Attorney General. Warrantor: GE Appliances, a Haier company /RXLVYLOOH.< IN CANADA (INCLUDING THE PROVINCE OF QUÉBEC): This limited warranty is extended to the original purchaser and any succeeding owner for products purchased in Canada LQFOXGLQJ4XpEHFIRUKRPHXVHZLWKLQ&DQDGDLQFOXGLQJ 4XpEHF,IWKHSURGXFWLVORFDWHGLQDQDUHDZKHUHVHUYLFHE\ a GE Appliances Authorized Servicer is not available, you may be responsible for a trip charge or you may be required to bring the product to an Authorized GE Appliances Service location. 6RPHSURYLQFHVLQFOXGLQJ4XpEHFGRQRWDOORZWKHH[FOXVLRQ or limitation of incidental or consequential damages. This limited warranty gives you specific legal rights, and you may also have other rights which vary from province to province LQFOXGLQJ4XpEHF7RNQRZZKDW\RXUOHJDOULJKWVDUHFRQVXOW your local or provincial consumer affairs office. FOR QUÉBEC CONSUMERS ONLY - NOTICE ON THE WARRANTY OF AVAILABILITY OF SPARE PARTS, REPAIR SERVICES AND INFORMATION NECESSARY FOR REPAIR OR MAINTENANCE (S. 39 OF THE CONSUMER PROTECTION ACT): Please be advised that MC Commercial ,QF ³0&&RPPHUFLDO´ GRHVQRWJXDUDQWHHZLWKLQWKH PHDQLQJRIVHFWLRQRIWKH&RQVXPHU3URWHFWLRQ$FW&4/5 F3DQGVHFWLRQVWRRIWKH5HJXODWLRQ respecting the application of the Consumer Protection $FW&4/5F3UWKHDYDLODELOLW\RIUHSODFHPHQW parts, repair services, or the information necessary for the maintenance or repair of goods manufactured, imported, advertised, or sold by MC Commercial. 3OHDVHQRWHWKDW0&&RPPHUFLDO,QFFRQWLQXHVWRRIIHUWKH manufacturer’s limited warranty as stated in the Owner’s 0DQXDORU4XLFN*XLGHDQGWKDWWKLVOLPLWHGZDUUDQW\LV distinct from the statutory warranty of availability provided for XQGHUVHFWLRQRIWKH&RQVXPHU3URWHFWLRQ$FW Warrantor: MC Commercial Inc., Burlington, ON, L7L 6B2 EXTENDED WARRANTIES: Purchase a GE Appliances extended warranty and learn about special discounts that are available while your warranty is still in effect. You can purchase it online anytime at bodewellcareplan.com or call 866-884-5646 during normal business hours. GE Appliances Service will still be there after your warranty H[SLUHV,Q&DQDGDFRQWDFW\RXUORFDOH[WHQGHGZDUUDQW\ provider. 49-2003957 Rev. 0 ACCESSORIES Looking For Something More? GE Appliances offers a variety of accessories to improve your cooking and maintenance experiences! Refer to the Consumer Support page for phone numbers and website information. 7KHIROORZLQJSURGXFWVDQGPRUHDUHDYDLODEOH Accessories Accessories 6PDOO%URLOHU3DQ ô´[ó´[ò³ /DUJH %URLOHU3DQ ô´[ó´[ò³ ;/ %URLOHU3DQ ´[ó´[³ Parts Oven racks Oven elements Light bulbs Probe Cleaning Supplies Stainless Steel Wipes Stainless Steel Appliance Cleaner Lubricant 7KHODUJHEURLOHUSDQGRHVQRWILWLQ´´UDQJHV 7KH;/EURLOHUSDQGRHVQRWILWLQ´ZDOORYHQV´GURSLQV RU´´UDQJHV 30 49-2003957 Rev. 0 3ULQWHGLQWKH8QLWHG6WDWHV Consumer Support CONSUMER SUPPORT In the United States ±9LVLWXVDW GEAppliances.com RUFDOO In Canada ±9LVLWXVDW GEAppliances.ca RUFDOO Find owner support information on our website : • Information • Register the Appliance • Schedule Service through Bodewell • Purchase Parts, Accessories or Extended Warranties • Connect your Appliance ± I f you are not satisfied with the service you receive, contact us on our website with all the details including your phone QXPEHURUZULWHWR In the United States - *HQHUDO0DQDJHU&XVWRPHU5HODWLRQV_*($SSOLDQFHV_$SSOLDQFH3DUN_/RXLVYLOOH.< In Canada - Director, Customer Relations | 0&&RPPHUFLDO,QF | %XUORDN'U6XLWH_%XUOLQJWRQ21//% GEAppliances.com GEAppliances.ca 49-2003957 Rev. 0 04-26 Four mural PTS9200 FOUR MURAL Électrique encastré MANUEL DE L'UTILISATEUR Inscrivez ici les numéros de modèle et de série : Nº de modèle ____________ Nº de série ______________ Vous trouverez ces numéros sur une étiquette située sur la garniture latérale ou à l'intérieur de la porte du four (four inférieur). GE est une marque de commerce de General Electric Company. Fabriqué sous licence d'utilisation de marque de commerce. SÉCURITÉ . . . . . . . . . . . . . . . . . . . . . . . . .3 UTILISATION DU FOUR Connectivité Wi-Fi . . . . . . . . . . . . . . . . . . . .6 Affichage de l’appareil . . . . . . . . . . . . . . . . .7 Réglages . . . . . . . . . . . . . . . . . . . . . . . . . . . . .9 Sabbat . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10 Grilles de four . . . . . . . . . . . . . . . . . . . . . . . . 11 Papier d'aluminium et protections pour four . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 Directives relatives aux ustensiles de cuisson . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 Modes de cuisson . . . . . . . . . . . . . . . . . . . . . 13 Sonde thermique . . . . . . . . . . . . . . . . . . . . . 17 Guide de cuisson . . . . . . . . . . . . . . . . . . . . . 18 Guide de friture à convection . . . . . . . . . 20 ENTRETIEN ET NETTOYAGE Nettoyage du four – Extérieur . . . . . . . . . . 21 Nettoyage du four – Intérieur . . . . . . . . . . .22 Sonde thermique . . . . . . . . . . . . . . . . . . . . .23 Grilles de four . . . . . . . . . . . . . . . . . . . . . . . .23 Lampe du four . . . . . . . . . . . . . . . . . . . . . . 24 Porte du four . . . . . . . . . . . . . . . . . . . . . . . . .25 CONSEILS DE DÉPANNAGE . . . 26 GARANTIE LIMITÉE . . . . . . . . . . . . .28 ACCESSOIRES . . . . . . . . . . . . . . . . . . 29 SERVICE À LA CLIENTÈLE . . . . 30 FRANÇAIS 2 49-2003957 Rev. 0 MERCI DE PERMETTRE À ÉLECTROMÉNAGERS GE DE FAIRE PARTIE DE VOTRE FOYER. Que vous ayez grandi avec des électroménagers GE ou qu'il s'agisse de votre premier appareil GE, nous sommes heureux de vous avoir dans la famille. Nous sommes fiers du savoir-faire, de l'innovation et du design qui font partie intégrante de tous les électroménagers GE que nous fabriquons, et nous pensons que vous le serez aussi. À cet égard, l'enregistrement de votre appareil nous assure que nous pourrons vous fournir des informations importantes sur votre appareil et des détails sur sa garantie si vous en avez besoin. Enregistrez votre électroménager GE en ligne dès maintenant. Des sites Web et des numéros de téléphone utiles sont disponibles dans la section « Service à la clientèle » de ce manuel de l'utilisateur. Vous pouvez également envoyer par courrier la carte d'enregistrement préimprimée qui se trouve dans l'emballage de votre appareil. 49-2003957 Rev. 0 3 LISEZ ET CONSERVEZ CES INSTRUCTIONS CONSIGNES DE SÉCURITÉ IMPORTANTES LISEZ TOUTES LES INSTRUCTIONS AVANT D'UTILISER L'APPAREIL SÉCURITÉ AVERTISSEMENT CONSIGNES GÉNÉRALES DE SÉCURITÉ Ŷ 8WLOLVH]FHWpOHFWURPpQDJHUXQLTXHPHQWDX[ILQV mentionnées dans ce manuel d’utilisation. Ŷ /¶LQVWDOODWLRQHWODPLVHjODWHUUHGRLYHQWrWUHUpDOLVpHVSDU un installateur qualifié en conformité avec les instructions d’installation fournies. Ŷ 7RXWUpJODJHUpSDUDWLRQRXHQWUHWLHQTXLQ¶HVWSDV spécifiquement recommandé dans le manuel d’utilisation GRLWrWUHHIIHFWXp81,48(0(17SDUXQLQVWDOODWHXU d’électroménagers ou un technicien d’entretien qualifiés. Ŷ $YDQWG¶HIIHFWXHUTXHOTXHUpSDUDWLRQFRXSH]O¶DOLPHQWDWLRQ électrique au panneau de distribution électrique du domicile en retirant le fusible ou en désarmant le disjoncteur Ŷ $VVXUH]YRXVTXHWRXWOHPDWpULHOG¶HPEDOODJHHVWUHWLUpGH la cuisinière avant l’utilisation afin de prévenir l’inflammation de ce matériel. Ŷ eYLWH]GHUD\HURXGHKHXUWHUOHVSRUWHVGHYHUUHOHVWDEOHV de cuisson ou les panneaux de commande. Cela pourrait causer le bris du verre. Ŷ 1HFXLVH]SDVG¶DOLPHQWVVXUXQSURGXLWGRQWOHYHUUHHVW brisé. Cela poserait un risque de décharge électrique, d’incendie ou de coupure. Ŷ 1HODLVVH]SDVOHVHQIDQWVVDQVVXUYHLOODQFH/HVHQIDQWV QHGRLYHQWSDVrWUHODLVVpVVHXOVQLVDQVVXUYHLOODQFHGDQV OD]RQHG¶XWLOLVDWLRQGHO DSSDUHLO,OVQHGRLYHQWMDPDLV grimper, s’asseoir ou se tenir debout sur l'appareil. Ŷ ATTENTION 1HUDQJH]SDVOHVREMHWVG LQWpUrW pour les enfants dans des armoires au-dessus d'un four, les enfants grimpant sur le four pour atteindre des objets SRXUUDLHQWrWUHJUDYHPHQWEOHVVpV Ŷ 1¶XWLOLVH]MDPDLVFHWpOHFWURPpQDJHUSRXUUpFKDXIIHURX chauffer la pièce. Ŷ 1HODLVVH]SHUVRQQHJULPSHUVHWHQLUGHERXWRXV DFFURFKHU à la porte du four, au tiroir ou à la table de cuisson. Cela pourrait endommager l'appareil ou le renverser et provoquer des blessures graves, voire mortelles. Ŷ 8WLOLVH]XQLTXHPHQWGHVPLWDLQHVGHIRXUVqFKHVOHFRQWDFW de mitaines humides ou mouillées sur des surfaces très chaudes peut causer des brûlures par la vapeur. Ne laissez pas les mitaines ou maniques isolantes toucher les éléments chauffants chauds. N’utilisez pas une serviette ou autre linge de grande taille à la place d’une poignée ou de mitaines. Ŷ 1HWRXFKH]SDVOHVEUOHXUVOHVSODTXHVGHFXLVVRQ (certains modèles), les grilles (certains modèles), la table de cuisson ou les éléments chauffants du four, ni la surface intérieure du four. Ces surfaces peuvent rester assez chaudes pour causer des brûlures, et ce, durant une longue SpULRGHDSUqVODFXLVVRQPrPHVLHOOHVQHVHPEOHQWSOXV rWUHDOOXPpHVRXFKDXGHV Ŷ 3HQGDQWHWDSUqVO¶XWLOLVDWLRQQHWRXFKH]SDVO¶LQWpULHXUGX IRXUHWQHODLVVH]SDVGHVYrWHPHQWVRXG¶DXWUHVPDWLqUHV inflammables entrer en contact avec une zone de l’intérieur du four; laissez d’abord suffisamment de temps pour refroidir. D’autres surfaces de l’électroménager peuvent devenir suffisamment chaudes pour causer des brûlures. /HVVXUIDFHVSRWHQWLHOOHPHQWFKDXGHVFRPSUHQQHQWOHV brûleurs ou les éléments chauffants, les grilles (certains modèles), la surface de la table de cuisson, les orifices des évents du four, les surfaces proches des ouvertures, les interstices autour de la porte du four, les pièces de garniture métalliques au-dessus de la porte, les dosserets ou les étagères situées au-dessus de la surface de cuisson. Ŷ 1HFKDXIIH]SDVGHVFRQWHQDQWVG DOLPHQWVQRQRXYHUWV /¶DXJPHQWDWLRQGHODSUHVVLRQSHXWIDLUHpFODWHUOH contenant et causer des blessures. Ŷ &XLVH]OHVDOLPHQWVjIRQGSRXUYRXVSUpPXQLUFRQWUH OHVPDODGLHVG¶RULJLQHDOLPHQWDLUH/HVUHFRPPDQGDWLRQV relatives à la température alimentaire minimale et VpFXULWDLUHVRQWIRXUQLHVSDUO 86'$HWOD)'$8WLOLVH]XQ thermomètre pour aliments et vérifiez à plusieurs endroits. Ŷ Gardez la hotte du ventilateur et les filtres à graisse propres afin de maintenir une bonne ventilation et prévenir les feux GHJUDLVVHe7(,*1(=OHYHQWLODWHXUHQFDVG LQFHQGLH/D soufflante en marche peut propager les flammes. AVERTISSEMENT 9HXLOOH]OLUHWRXWHVOHVFRQVLJQHVDYDQWG¶XWLOLVHUFHSURGXLW/HQRQUHVSHFWGHFHVLQVWUXFWLRQV pourrait entraîner un incendie, un choc électrique, une blessure grave voire la mort. AVERTISSEMENT GARDER LES MATÉRIAUX INFLAMMABLES À L’ÉCART DE LA TABLE DE CUISSON Le non-respect de ces instructions pourrait entraîner un incendie ou une blessure. Ŷ $EVWHQH]YRXVGHUDQJHURXG¶XWLOLVHUGHVPDWpULDX[ inflammables dans ou à proximité du four, y compris du papier, du plastique, des poignées, des nappes, des UHYrWHPHQWVPXUDX[GHVULGHDX[GHVVWRUHVDLQVLTXHGH l’essence ou d’autres vapeurs ou liquides inflammables. Ŷ 1HSRUWH]MDPDLVGHYrWHPHQWVDPSOHVRXSHQGDQWV ORUVGHO¶XWLOLVDWLRQGHO¶pOHFWURPpQDJHU&HVYrWHPHQWV pourraient s’enflammer s’ils entrent en contact avec des surfaces chaudes, ce qui pourrait entraîner des brûlures graves. Ŷ 1HODLVVH]SDVODJUDLVVHGHFXLVVRQRXG¶DXWUHVPDWLqUHV inflammables s’accumuler dans ou à proximité du four. Ces matières pourraient prendre feu. Ŷ 1HUDQJH]SDVGHVPDWLqUHVLQIODPPDEOHVRXGHVDUWLFOHV sensibles à la température à l’intérieur de l’électroménager. Ŷ 1HWWR\H]IUpTXHPPHQWOHVKRWWHVGHYHQWLODWLRQ1HODLVVH] pas la graisse s’accumuler sur la hotte ou le filtre. Ŷ (Sur certains modèles) Fonctionnement à distance - Cet appareil est configurable pour permettre un fonctionnement à distance à tout moment. 4 49-2003957 Rev. 0 SÉCURITÉ LISEZ ET CONSERVEZ CES INSTRUCTIONS CONSIGNES DE SÉCURITÉ IMPORTANTES LISEZ TOUTES LES INSTRUCTIONS AVANT D'UTILISER L'APPAREIL AVERTISSEMENT EN CAS D'INCENDIE, PRENEZ LES MESURES SUIVANTES POUR ÉVITER LES BLESSURES ET LA PROPAGATION DU FEU Ŷ 1HYHUVH]SDVG HDXVXUXQIHXGHJUDLVVH1HSUHQH] MDPDLVXQHFDVVHUROHHQIODPPHV0HWWH]OHVFRPPDQGHV jODSRVLWLRQG¶DUUrW 2)) eWRXIIH]XQHFDVVHUROHHQ flammes sur un brûleur de surface en la recouvrant complètement avec un couvercle bien ajusté, une tôle à ELVFXLWVRXXQSODWHDXSODW8WLOLVH]XQH[WLQFWHXUjPRXVVH ou à poudre chimique multi-usages. Ŷ 6LXQIHXVHGpFODUHGDQVOHIRXUSHQGDQWODFXLVVRQ étouffez-le en fermant la porte du four et en éteignant le IRXU 2)) RXHQXWLOLVDQWXQH[WLQFWHXUjSRXGUHVqFKHRX à mousse. Ŷ 6XUFHUWDLQVPRGqOHV 6LXQIHXVHGpFODUHGDQVOHIRXU pendant l’autonettoyage, éteignez le four et attendez que le feu s’éteigne. Ne forcez pas l’ouverture de la SRUWH/¶LQWURGXFWLRQG¶DLUIUDLVjGHVWHPSpUDWXUHV d’autonettoyage peut provoquer un jaillissement de IODPPHVGDQVOHIRXU/¶RPLVVLRQG¶REVHUYHUFHWWH instruction peut occasionner des brûlures graves. AVERTISSEMENT CONSIGNES DE SÉCURITÉ DU FOUR Ŷ 7HQH]YRXVjO¶pFDUWORUVTXHYRXVRXYUH]ODSRUWHGXIRXU /DYDSHXURXO¶DLUFKDXGVTXLV¶pFKDSSHQWSHXYHQWEUOHU les mains, la figure et/ou les yeux. Ŷ 6LO¶pOpPHQWFKDXIIDQWGDQVO¶DSSDUHLOGpYHORSSHXQH tache incandescente ou montre d’autres signes de GRPPDJHVQ¶XWLOLVH]SDVFHWWH]RQHGHO¶DSSDUHLO8QH tache incandescente indique que l'élément peut tomber en panne et présenter un risque de brûlure, d'incendie ou de GpFKDUJHpOHFWULTXHeWHLJQH]LPPpGLDWHPHQWO DSSDUHLO et faites remplacer l'élément chauffant par un technicien qualifié. Ŷ 1HEORTXH]SDVOHVpYHQWVGXIRXU Ŷ 1HSODFH]MDPDLVG XVWHQVLOHVGHSLHUUHVjSL]]DRX de cuisson, ou tout type de papier aluminium ou de UHYrWHPHQWVXUOHSODQFKHUGXIRXU&HVDUWLFOHVSHXYHQW emprisonner la chaleur ou fondre, endommageant le produit et causant un risque de décharge électrique, d'enfumage ou d'incendie. Ŷ /HIRXUGRLWrWUHUHIURLGLDYDQWGHSODFHUOHVJULOOHVGXIRXU DX[HPSODFHPHQWVGpVLUpV6LODJULOOHGRLWrWUHGpSODFpH alors que le four est chaud, veillez à ne pas toucher les surfaces chaudes et ne laissez pas la mitaine isolante entrer en contact avec l’élément chauffant du four. Ŷ 1HODLVVH]SDVGHVDUWLFOHVWHOVTXHGXSDSLHUGHV ustensiles de cuisson ou des aliments dans le four lorsqu’il Q¶HVWSDVXWLOLVp/HVDUWLFOHVUDQJpVGDQVOHIRXUSHXYHQW s’enflammer. Ŷ 1HODLVVH]SDVGHVDUWLFOHVVXUODWDEOHGHFXLVVRQSUqVGH O¶pYHQWGXIRXU/HVDUWLFOHVSHXYHQWVXUFKDXIIHUHWSRVHU un risque d’incendie ou de brûlure. Ŷ 1HJULOOH]MDPDLVDYHFODSRUWHRXYHUWH Ŷ *DUGH]OHIRXUH[HPSWG¶DFFXPXODWLRQGHJUDLVVH/D graisse dans le four peut prendre feu. Ŷ /RUVTXHYRXVXWLOLVH]GHVVDFVGHFXLVVRQRXGHU{WLVVHULH dans le four, suivez les directives du fabricant. Ŷ RISQUE DE DÉCHARGE ÉLECTRIQUE OU DE BRÛLURE : $YDQWGHUHSODFHUO¶DPSRXOHGXIRXUFRXSH] l’alimentation électrique du four au fusible principal ou DXSDQQHDXGXGLVMRQFWHXU/¶RPLVVLRQGHSUHQGUHFHWWH précaution peut occasionner une décharge électrique ou une brûlure. Ŷ ATTENTION RISQUE DE BRÛLURE : $WWHQGH]TXH le couvercle de verre et l’ampoule soient refroidis avant de OHVUHWLUHU7RXFKHUGXYHUUHFKDXGDYHFOHVPDLQVQXHVRX un linge humide peut causer des brûlures. Ŷ 1 XWLOLVH]DXFXQW\SHGHSDSLHUDOXPLQLXPRXGHUHYrWHPHQW pour couvrir le fond du four ou n'importe où dans le four, sauf WHOTXHGpFULWGDQVOHPDQXHOG¶XWLOLVDWLRQ/HVGRXEOXUHVGH four peuvent emprisonner la chaleur ou fondre, endommageant le produit et causant un risque de choc électrique, d'enfumage ou d'incendie. AVERTISSEMENT CONSIGNES DE SÉCURITÉ DU FOUR AUTONETTOYANT (Sur certains modèles) /DIRQFWLRQG¶DXWRQHWWR\DJHpOqYHODWHPSpUDWXUHGXIRXUjGHVGHJUpVVXIILVDQWVSRXUEUOHUFRPSOqWHPHQWOHVVDOLVVXUHV alimentaires dans le four. Suivez les instructions suivantes pour un fonctionnement sûr. Ŷ 1HWRXFKH]SDVOHVVXUIDFHVGXIRXUSHQGDQWOHSURFHVVXV d’autonettoyage. Gardez les enfants à l’écart du four SHQGDQWO¶DXWRQHWWR\DJH/¶RPLVVLRQG REVHUYHUFHV instructions peut occasionner des brûlures. Ŷ $YDQWG XWLOLVHUOHF\FOHG DXWRQHWWR\DJHUHWLUH]OHV casseroles, les grilles de four en métal brillant, tout papier d'aluminium et tout autre ustensile du four. Seules les JULOOHVGHIRXUUHYrWXHVGHSRUFHODLQHGHFRXOHXUIRQFpH SHXYHQWrWUHODLVVpHVGDQVOHIRXU/HQRQUHVSHFWGH cette consigne peut endommager ces articles et le four, et présenter un risque de brûlure ou d'incendie. 49-2003957 Rev. 0 5 SÉCURITÉ LISEZ ET CONSERVEZ CES INSTRUCTIONS CONSIGNES DE SÉCURITÉ IMPORTANTES LISEZ TOUTES LES INSTRUCTIONS AVANT D'UTILISER L'APPAREIL AVERTISSEMENT CONSIGNES DE SÉCURITÉ DU FOUR AUTONETTOYANT (Sur certains modèles) (suite) Ŷ $YDQWG¶XWLOLVHUOHF\FOHG¶DXWRQHWWR\DJHHVVX\H]OD JUDLVVHHWOHVVDOLVVXUHVDOLPHQWDLUHVGDQVOHIRXU8QH quantité excessive de graisse peut s’enflammer et causer des dommages par la fumée. Ŷ 6LOHPRGHG¶DXWRQHWWR\DJHQHIRQFWLRQQHSDVELHQ éteignez le four et débranchez l’alimentation électrique. Faites réparer l’appareil par un technicien qualifié. Ŷ 1¶XWLOLVH]SDVGHQHWWR\DQWVSRXUOHIRXU$XFXQQHWWR\DQW SRXUIRXUFRPPHUFLDORXUHYrWHPHQWGHSURWHFWLRQSRXU IRXUGHTXHOTXHVRUWHTXHFHVRLWQHGRLWrWUHXWLOLVpGDQV RXDXWRXUG XQHSDUWLHGXIRXUjPRLQVG rWUHFHUWLILpSRXU une utilisation dans un four autonettoyant. Ŷ 1HQHWWR\H]SDVOHVMRLQWVG¶pWDQFKpLWpGHSRUWH&HVMRLQWV sont essentiels pour garantir l’étanchéité. Veillez à ne pas frotter, endommager ou déplacer les joints. Ŷ IMPORTANT: &HUWDLQVRLVHDX[VRQWH[WUrPHPHQW sensibles aux vapeurs dégagées durant le cycle G¶DXWRQHWWR\DJHGHQ¶LPSRUWHTXHOOHFXLVLQLqUH3ODFH]OHV oiseaux dans une autre pièce, bien ventilée. MISE AU REBUT ADÉQUATE DE VOTRE ÉLECTROMÉNAGER Veuillez jeter ou recycler votre électroménager conformément aux règlements fédéraux ou locaux. Communiquez avec les instances locales pour en savoir plus sur la mise au rebut ou le recyclage de votre électroménager. Comment retirer le film protecteur d’expédition et le ruban adhésif d’emballage Saisissez délicatement un coin du film protecteur d’expédition avec vos doigts et le décoller lentement de la surface de l’appareil. N’utilisez pas d’objets pointus pour retirer le film. Retirez complètement le film avant d’utiliser l’appareil pour la première fois. 3RXUDVVXUHUQHSDVHQGRPPDJHUODILQLWLRQGXSURGXLWOD façon la plus sûre pour enlever le ruban adhésif de l’emballage sur les nouveaux appareils consiste à appliquer un détergent à vaisselle liquide à l’aide d’un chiffon doux et à laisser tremper. REMARQUE : 7RXVOHVHPEDOODJHVGHSURWHFWLRQGRLYHQWrWUH retirés de toutes les pièces. Cela sera impossible une fois cuits. Considérez les options de recyclage des matériaux d’emballage de votre électroménager. INFORMATION RÉGLEMENTAIRE Déclaration de conformité FCC/IC : &HWDSSDUHLOHVWFRQIRUPHjODSDUWLHGHVUqJOHVGHOD)&&/¶XWLOLVDWLRQGHFHWpTXLSHPHQWHVWDVVXMHWWLHDX[GHX[ conditions suivantes : 1. Cet appareil ne doit pas causer de brouillage préjudiciable; et 2. Cet appareil doit accepter tout brouillage qu’il reçoit, y compris celui pouvant entraîner un fonctionnement indésirable. AVIS : 7RXWFKDQJHPHQWRXWRXWHPRGLILFDWLRQDSSRUWpjFHWWHXQLWpTXLQ¶DSDVpWpH[SUHVVpPHQWDSSURXYpSDUOHIDEULFDQW pourrait annuler l’autorisation de l’utilisateur d’utiliser cet équipement. AVERTISSEMENT 6XUFHUWDLQVPRGqOHV &HIRXUSHXWrWUHpTXLSpG¶XQPLFURSKRQHDILQGHSHUPHWWUHOHFRQWU{OH YRFDOGHVIRQFWLRQVGHYRWUHIRXU/¶DFWLYDWLRQGXPLFURSKRQHOXLSHUPHWWUDG¶pFRXWHUHQWRXWWHPSVFHUWDLQVPRWVFOpVSRXU DFWLYHUHWIDLUHIRQFWLRQQHUOHIRXU,OHVWSRVVLEOHTXHGHVEUXLWVGHIRQGRXGHVVRQVDPELDQWVLPLWHQWGHVPRWVRXGHVVRQV que cet appareil reconnaît comme une commande, et l’appareil pourrait alors s’activer ou lancer une fonction ou un mode de FXLVVRQPrPHVLO¶DSSDUHLOHVWODLVVpVDQVVXUYHLOODQFHHWTX¶DXFXQHDFWLYDWLRQGHODIRQFWLRQRXGXPRGHGHFXLVVRQQ¶pWDLW souhaitée. Ne rangez jamais de matières inflammables ou d’articles sensibles à la chaleur à l’intérieur de l’appareil. 6 49-2003957 Rev. 0 Connectivité Wi-Fi Votre appareil est conçu pour vous offrir une communication bidirectionnelle entre votre appareil et des appareils intelligents. De plus, cet appareil peut nécessiter une mise à jour logicielle afin d’activer toutes les fonctions lors de la configuration initiale. En utilisant l’application mobile SmartHQ™, vous pourrez accéder à diverses fonctions (y compris, sans s’y limiter, l’utilisation de votre appareil comme KDXWSDUOHXULQWHOOLJHQWDYHF$PD]RQ$OH[D HWXWLOLVHUYRWUH téléphone intelligent ou votre tablette*. Visitez votre boutique d’applications et téléchargez Smart HQ ou utilisez le code QR ci-dessous : 3RXUFRQQHFWHUYRWUHDSSDUHLODX:L)LVXLYH]OHVLQVWUXFWLRQV DIILFKpHVVXUO¶pFUDQGHFRPPDQGHGHO¶DSSDUHLO3RXUXQH expérience optimale, avant de commencer : 7pOpFKDUJH]O¶DSSOLFDWLRQ6PDUW+4HWRXYUH]XQHVHVVLRQRX créez un compte. REMARQUE : /HVQRXYHDX[XWLOLVDWHXUVGRLYHQWYpULILHUOHXU adresse courriel pour terminer le processus de connexion. $\H]jSRUWpHGHPDLQOHPRWGHSDVVHGHYRWUHUpVHDX:L)L GRPHVWLTXH6LXQLGHQWLILDQW0$&HVWUHTXLVSRXUFRQQHFWHU YRWUHDSSDUHLODX:L)LFRQVXOWH]ODVHFWLRQ3DUDPqWUHVSRXU plus de détails. Vous pouvez également consulter l’étiquette d’information sur l’appareil connecté, généralement située à l’intérieur de la porte du four ou du tiroir. Elle contiendra pJDOHPHQWOHQRPGXUpVHDXGHO¶DSSDUHLO $SSOLDQFH1HWZRUN Name) et le mot de passe, au besoin. 8QHIRLVYRWUHDSSDUHLOFRQQHFWpODQFH]O¶DSSOLFDWLRQ6PDUW+4 HWWRXFKH]YRWUHDSSDUHLOSRXUH[SORUHU$SSOLTXH]WRXWHVOHV mises à jour logicielles si cela vous est demandé afin de vous assurer que votre appareil dispose des fonctionnalités les plus récentes. NOTA : $VVXUH]YRXVGHJDUGHUODIRQFWLRQ:L)LDFWLYpHDILQ de pouvoir contrôler votre appareil à partir de l’application SmartHQ. Si vous éprouvez des difficultés lors du processus de connexion, veuillez composer le 800.220.6899 et demander de l’aide pour la connectivité sans fil. $SSDUHLOV$SSOHRX$QGURLGFRPSDWLEOHVHWUpVHDX:L)L domestique requis. Désactivation du Wi-Fi Si vous avez un bouton Remote Enable (accès à distance activé) ou Wi-Fi Connect (connexion Wi-Fi), appuyez sur le bouton et maintenez-le enfoncé pendant 3 secondes pour vous déconnecter complètement du Wi-Fi. Si vous n’avez SDVGHERXWRQVXUYRVFRPPDQGHVDFFpGH]j3DUDPqWUHV et sélectionnez « déconnecter » ou « oublier le réseau » pour vous déconnecter complètement du Wi-Fi. NOTA : Vous devrez reconnecter l’application SmartHQ à votre appareil si vous souhaitez à nouveau contrôler votre appareil à partir de votre téléphone. Notez que lorsque le Wi-Fi est désactivé, la carte Wi-Fi du four ne diffuse pas de signal. Fonctionnalités disponibles Suivez toutes les instructions affichées dans l’application pour assurer le bon fonctionnement de l’appareil lors de l’utilisation des fonctionnalités connectées. Contrôle du four à distance : 3RXUDFWLYHUOHFRQWU{OHGXIRXUYLD6PDUW+4ORUVTXHOH:L)L est actif, assurez-vous que la fonction est activée en vérifiant le paramètre remote enable (accès à distance) dans Settings (paramètres). Activation vocale : Vous avez la possibilité de contrôler le fonctionnement de votre four simplement avec votre voix. Vous pouvez utiliser votre voix pour allumer un four, activer OHVPLQXWHULHVGXIRXURXpWHLQGUHXQIRXU$VVXUH]YRXVTXH votre four est connecté au Wi-Fi, que l’application SmartHQ est connectée, que la fonction remote enable (contrôle à distance) du four est activée et que le panneau de commande du four est déverrouillé. Veillez également à ce que vous soyez FRQQHFWpjXQKDXWSDUOHXULQWHOOLJHQW$PD]RQ$OH[DHWTXHFH haut-parleur soit placé à proximité de votre four afin qu’il puisse entendre vos commandes. REMARQUE : Certaines fonctions et caractéristiques ne seront pas accessibles tant que vous n’aurez pas effectué la connexion Wi-Fi de votre nouveau four au réseau sans fil de votre maison. Veuillez suivre les instructions ci-dessus pour effectuer la connexion. Ces dernières permettront d’utiliser les fonctions de l’application SmartHQ et d’assurer que la récente mise à jour du logiciel soit téléchargée. Contains FCC: UPD ID: PT. NO. Contains IC: MAC ID: Connected Appliance Information UTILISATION DU FOUR : Connectivité Wi-Fi 49-2003957 Rev. 0 7 Affichage de l’appareil ÉCRAN D’ACCUEIL 1 - Commande du four Située complètement à gauche de l’écran d’accueil de O¶DIILFKDJHGXIRXU$VVXUH]YRXVGHIDLUHJOLVVHUFRPSOqWHPHQW vers la gauche si elle n’apparaît pas lorsque l’affichage du four s’active. Four supérieur et four inférieur Vous pouvez sélectionner différents modes de cuisson dans chaque four. Sélectionnez d’abord le four à utiliser, puis sélectionnez le mode de cuisson désiré. Écran de sélection du mode de cuisson Sélectionnez votre préférence de cuisson dans cette zone. Vous pouvez choisir entre les modes de cuisson traditionnels RXOHVPRGHVGHFXLVVRQGHSUpFLVLRQ9R\H]ODVHFWLRQ0RGHV de cuisson pour plus de détails sur les différents modes de cuisson traditionnelle et de cuisson de précision offerts. $VVXUH]YRXVGHFRQQHFWHUYRWUHIRXUDILQGHSRXYRLU télécharger de nouveaux modes de cuisson de précision dès qu’ils sont disponibles. 2 - Volet des réglages rapides Faites glisser ce menu vers le bas pour accéder à l’éclairage du four, au verrouillage des commandes, au microphone (sur certains modèles), aux haut-parleurs, à la luminosité de O¶DIILFKDJHjODGLVSRVLWLRQGXPHQX$PELHQWDX[DOHUWHVHW aux réglages. Éclairage du four 3RXUDOOXPHURXpWHLQGUHOHVOXPLqUHVGHODFDYLWpGXIRXU appuyez sur le . Verrouillage des commandes Sélectionnez cette option pour verrouiller la commande du four DILQG¶HPSrFKHUWRXWHVpOHFWLRQQRQGpVLUpHjO¶pFUDQ3RXU verrouiller, appuyez sur le bouton $SSX\H]HWPDLQWHQH]OH bouton enfoncé pour déverrouiller. Luminosité 8WLOLVH]ODEDUUHGHGpILOHPHQWSRXUUpJOHUODOXPLQRVLWpGH l’écran selon vos préférences. Ambiance $SSX\H]VXUOHERXWRQ Ambient pour accéder directement à O¶pFUDQ$PELHQW Paramètres $SSX\H]VXUOHERXWRQ Settings pour accéder au menu Settings (paramètres). Consultez la section Settings (paramètres) pour la liste complète des options disponibles. My Oven Oven Meal Planning Stay Informed Tools 1:59 PM 1 2 3 4 5 UTILISATION DE L’APPAREIL : $IILFKDJHGHO¶DSSDUHLO 8 49-2003957 Rev. 0 Affichage de l’appareil ÉCRAN D’ACCUEIL(suite) 3 - Barre d’état Dans le coin supérieur droit, affiche les alertes actives, l’état du microphone (sur certains modèles), l’état du Wi-Fi et O¶KHXUH8WLOLVH]FHWWHEDUUHFRPPHUpIpUHQFHUDSLGHORUVGH l’utilisation du four. 4 - Barre de navigation Flèche de retour Vous ramène à l’écran précédent jusqu’à ce que vous atteigniez l’écran d’accueil. Bouton Accueil Vous amène directement à l’écran d’accueil où la section 2YHQ&RQWURO FRPPDQGHGXIRXU HVWYLVLEOH Bouton Oven / boutons Oven Vous amène à l’écran du four affichant ce qui est en cours si le four est utilisé. Si le four sélectionné n’est pas en cours d’utilisation, vous serez dirigé vers l’écran de sélection du mode pour le four choisi. Barre d’activité Située au bas de l’affichage de l’appareil, cette barre indique que le four est actuellement allumé. Cette barre ne s’affiche pas lorsque le four est éteint. Cette fonction s’affiche uniquement lorsque le four est allumé. 5 - Applications Connectez votre four pour profiter de toutes les fonctionnalités des applications sur votre panneau de commande. Certaines DSSOLFDWLRQVQHSHXYHQWrWUHXWLOLVpHVTXHVLYRWUHIRXUHVW FRQQHFWpDX:L)L3DUPLOHVDSSOLFDWLRQVRIIHUWHVRQUHWURXYH la météo et le minuteur de cuisine. Faites glisser vers la droite pour accéder à d’autres applications ainsi qu’à l’assistant SmartHQ (sur les modèles GRWpVG¶XQPLFURSKRQHVHXOHPHQW HWjO¶LQIRUPDWLRQ2YHQ 7LSV FRQVHLOVSRXUOHIRXU Minuteries /¶DSSOLFDWLRQGHPLQXWHULHIRQFWLRQQHFRPPHXQPLQXWHXU à rebours. Vous pouvez régler une nouvelle minuterie ou sélectionner une minuterie existante. Sélectionnez « Add a Timer » (Ajouter une minuterie) ou « Timer » (Minuterie) , réglez la durée de la minuterie en heures:minutes:secondes, nommez la minuterie si vous VRXKDLWH]ODUpXWLOLVHUSXLVGpPDUUH]ODPLQXWHULH8QHIRLVOD minuterie démarrée, il n’est plus possible de modifier son nom. 3OXVLHXUVPLQXWHULHVSHXYHQWrWUHUpJOpHVHWUpXWLOLVpHV indépendamment ou simultanément. 6LSOXVGHGHX[PLQXWHULHVVRQWUpJOpHVHQPrPHWHPSVOHV deux minuteries les plus récemment programmées s’afficheront GDQVODVHFWLRQ©$SSVª $SSOLFDWLRQV 3RXUDIILFKHUWRXWHVOHVPLQXWHULHVDFWLYHVHWWRXWHVOHV minuteries précédemment réglées, sélectionnez l’application de minuterie pour accéder à la liste et faites glisser pour voir les minuteries actives, réutiliser une minuterie ou supprimer une minuterie. /¶DIILFKDJHGHO¶DSSDUHLOYRXVDYLVHUDORUVTXHODPLQXWHULHVHUD terminée. UTILISATION DE L’APPAREIL : $IILFKDJHGHO¶DSSDUHLO 49-2003957 Rev. 0 9 Set Clock (réglage de l'horloge) Cette fonction (pas disponible lorsque non connecté) sert à régler l'horloge et à spécifier la façon dont sera affichée l'heure GXMRXU9RXVSRXYH]VpOHFWLRQQHUOHPRGHKHXUHVDYHF$0 HW30RXOHPRGHKHXUHV Sons et alertes Cet écran de réglages vous permet de modifier le volume, l’alerte de fin de cycle et d’activer ou désactiver le son tactile. Affichage et apparence Cet écran affiche les options de luminosité et Energy saver (économie d’énergie). Paramètres de l’appareil Ŷ UNITÉS DE TEMPÉRATURE : /HIRXUHVWUpJOpSRXU afficher les degrés Fahrenheit, mais dans ce réglage, vous pouvez le changer aux degrés Celsius. Ŷ AJUSTE LA TEMPÉRATURE DU FOUR: Cette fonction permet d’ajuster la température du four jusqu’à 35 °F (19,4 °C) plus chaude ou 35 °F (19,4 °C) plus froide. 8WLOLVH]FHWWHIRQFWLRQVLYRXVFUR\H]TXHODWHPSpUDWXUH de votre four est trop chaude ou trop froide et souhaitez ODPRGLILHU3RXUOHVIRXUVGRXEOHVOHVWHPSpUDWXUHVGHV IRXUVVXSpULHXUHWLQIpULHXUV¶DMXVWHQWVpSDUpPHQW1(3$6 utiliser de thermomètres, comme ceux vendus en épicerie, pour vérifier le réglage de la température de votre four. Ces thermomètres peuvent varier de 20 à 40 degrés. Ŷ CONVERSION AUTOMATIQUE DE RECETTE: / RSWLRQ $XWR5HFLSH&RQYHUVLRQ FRQYHUVLRQDXWRPDWLTXHGH UHFHWWH SHXWrWUHDFWLYpHSRXUDXWRPDWLTXHPHQWUpGXLUHOD température de cuisson programmée pour la cuisson à convection ou la cuisson à convection multiple. Veuillez noter que cela ne réduit que la température de cuisson, pas la durée de la cuisson. Ŷ ARRÊT AUTOMATIQUE APRÈS 12 HEURES : /RUVTXH O RSWLRQ+RXU6KXW2II DUUrWDSUqVKHXUHV HVW activée, le four s'éteindra automatiquement après 12 heures d'utilisation continue. Ŷ ARRÊT AUTOMATIQUE DE LA LUMIÈRE DU FOUR : $FWLYH]FHWWHIRQFWLRQSRXUTXHODOXPLqUHGXIRXUV¶pWHLJQH DXWRPDWLTXHPHQWDSUqVODFXLVVRQHWO¶DUUrWGXIRXU SmartHQ Account 3HUPHWGHYRXVFRQQHFWHUjYRWUHFRPSWH6PDUW+4VXUYRWUH four. Cette fonction facilite également la connexion de votre four à votre compte SmartHQ. Wi-Fi 3HUPHWGHYRXVFRQQHFWHUjYRWUHUpVHDX:L)LRXGH l’oublier. Remote Enable (activation à distance) $FWLYH]FHWWHIRQFWLRQSRXUFRQWU{OHUYRWUHIRXUjGLVWDQFH via l’application une fois votre four connecté. Ambient Mode (mode ambiant) 3HUPHWGHFRQILJXUHUO¶pFUDQDPELDQW Système Cet écran vous permet d’effacer vos données utilisateur enregistrées et affiche la versions actuelle du logiciel DLQVLTXHOH0$&,' LGHQWLILDQW0$& Settings (Paramètres) UTILISATION DE L’APPAREIL : 6HWWLQJV 3DUDPqWUHV 10 49-2003957 Rev. 0 Settings (Paramètres) Sabbat 9RWUHFXLVLQLqUHRIIUHXQPRGHVDEEDWLTXHFRQIRUPHDX[QRUPHVpWDEOLHVSDU2UWKRGR[8QLRQOH&HQWUDO5DEELQLFDO&RQJUHVVHW +DODFKD7HFKHWHVWFHUWLILpHjVHORQOHVSOXVKDXWVVWDQGDUGVKDODFKLTXHV'DQVFHPRGHOHVOXPLqUHVGXIRXUVHURQWpWHLQWHV pendant toute la durée d’utilisation et les signaux sonores du four seront désactivés. REMARQUE : $VVXUH]YRXVTXHO¶KRUORJHGXIRXUHVWH[DFWHDYDQWG¶DFWLYHUOHPRGH3RXUXQIRQFWLRQQHPHQWFRQIRUPHDX VDEEDWOHPRGHGRLWrWUHODQFpGDQVODIHQrWUHG¶XQHKHXUHSUpFpGDQWOHFRXFKHUGXVROHLO Utilisation du mode sabbatique $FFpGH]DXPHQX Settings (paramètres) et sélectionnez Sabbath (sabbatique) . 6pOHFWLRQQH]ODFRPELQDLVRQVRXKDLWpHGH6DEEDWK0RGH PRGHVDEEDWLTXH RX+ROLGD\0RGH PRGHIrWH SDUPL les options proposées et appuyez sur Start (démarrer) . /¶DIILFKDJHLQGLTXHUDTXHOPRGHVDEEDWLTXHRXIrWHHVWHQ cours d’utilisation. /HVRSWLRQVFRPSUHQDQW+ROLGD\ IrWH HW6DEEDWK VDEEDWLTXH passeront automatiquement d’une fonction à l’autre selon O¶KHXUHLQLWLDOHHQWUpHGDQVODIHQrWUHG¶XQHKHXUHDYDQWOH coucher du soleil. 3RXUOHVRSWLRQVGHPDLQWLHQDXFKDXG6DEEDWKLQIpULHXUHV à 24 heures, l’appareil terminera la fonction Sabbath Warm (réchauffement sabbatique) puis passera en mode Sabbath ,GOH YHLOOHVDEEDWLTXH SRXUOHUHVWHGHODSpULRGHGH KHXUHV/HVOXPLqUHVGXIRXUUHVWHURQWpWHLQWHVOHVVLJQDX[ sonores du four resteront désactivés, le chauffage du four sera désactivé et l’affichage indiquera que le four est en veille. Panne de courant en mode sabbatique Si une panne de courant survient pendant l’utilisation des modes Sabbath Warm (réchauffement sabbatique) ou Holiday IrWH O¶DSSDUHLOUHYLHQGUDj6DEEDWK:DUP UpFKDXIIHPHQW sabbatique) pour le reste de l’horaire choisi. Si la panne VXUYLHQWSHQGDQW6DEEDWK,GOH YHLOOHVDEEDWLTXH O¶DSSDUHLO UHYLHQGUDj6DEEDWK,GOH YHLOOHVDEEDWLTXH SRXUOHUHVWHGH l’horaire choisi. Température de maintien au chaud en mode sabbat 8WLOLVH]O¶RSWLRQ6HWWLQJV6DEEDWK:DUPHU UpFKDXIIHXU sabbatique) pour augmenter la température de Sabbath Warm (réchauffement sabbatique) si le four fonctionne à une température inférieure à celle désirée ou si votre four IRQFWLRQQHjYROWV$FFpGH]j Appliance Settings (Réglages) , sélectionnez Sabbath Warm Temperature (Température de maintien au chaud en mode sabbat). UTILISATION DE L’APPAREIL : Sabbat 49-2003957 Rev. 0 11 Grilles de four UTILISATION DE L’APPAREIL : Grilles de four /HVSRVLWLRQVGHJULOOHUHFRPPDQGpHVSRXUGLYHUVW\SHV G¶DOLPHQWVILJXUHQWGDQVOH*XLGHGHFXLVVRQ/HUpJODJHGHOD position de la grille est une façon d’influencer les résultats de la FXLVVRQ3DUH[HPSOHVLYRXVSUpIpUH]GHVGHVVXVGHJkWHDX[ de muffins ou de biscuits plus grillés, montez la grille d’une position. Si vous trouvez que les aliments brunissent trop, descendez-les la prochaine fois. /RUVTXHYRXVIDLWHVFXLUHSOXVLHXUVSODWVVXUSOXVLHXUVJULOOHV assurez-vous qu’il y ait suffisamment d’espace entre les plats pour permettre à l’air de circuler. 3RXUpYLWHUOHVEUOXUHVSODFH]OHVJULOOHVjODSRVLWLRQGpVLUpH avant d’allumer le four. Pour les charges hautes dans le four inférieur 5HWLUH]OHVJULOOHVFRXOLVVDQWHVGXIRXU3ODFH]ODJULOOHIRXUQLH au fond du four, tel qu’illustré. Notez que cette grille ne s’insère pas dans les glissières sur les côtés du four. Grilles coulissantes /RUVTXHYRXVPHWWH]GHVXVWHQVLOHVGHFXLVVRQGDQVOHIRXU ou les en retirez, tirez toujours la grille à la position d’extension PD[LPDOHHQXWLOLVDQWODEDUUHVXSpULHXUHDYDQW/HVJULOOHV FRXOLVVDQWHVQHSHXYHQWrWUHXWLOLVpHVjODSRVLWLRQGHJULOOH supérieure. Si les grilles coulissantes sont difficiles à tirer, lubrifiez-les conformément à la section Entretien et nettoyage du présent manuel. Pour retirer une grille coulissante : $VVXUH]YRXVTXHODJULOOHHVWSRXVVpHFRPSOqWHPHQWGDQVOH four afin que les palettes latérales de la grille se désengagent du support du four. 2. Faites glisser la grille vers vous jusqu’à la butée (position G¶DUUrW VXUOHVXSSRUWGHJULOOH 3. Saisissez fermement les deux côtés du cadre de la grille et de la grille coulissante, soulevez l’avant et retirez-la. Pour remettre une grille coulissante : 1. Saisissez fermement les deux côtés du cadre de la grille et de la grille coulissante. 3ODFH]O¶H[WUpPLWpFRXUEpHGHODJULOOH YHUURXVG¶DUUrW VXUOHV supports du four, soulevez l’avant de la grille et poussez-la aussi loin que possible. Si les grilles extensibles sont difficiles à replacer ou à retirer, appliquez de l’huile végétale sur un chiffon doux ou un essuie- tout et essuyez les supports de grille du four. Ne mettez pas d’huile sur les glissières des grilles. REMARQUE : /¶XWLOLVDWLRQG¶DXWUHVKXLOHVGHFXLVVRQFRPPH O¶KXLOHG¶DUDFKLGH3DP ® ou d’autres aérosols lubrifiants, peut entraîner une décoloration ou la formation d’un résidu de couleur semblable à de la rouille sur les grilles et les parois de ODFDYLWp3RXUQHWWR\HUFHUpVLGXXWLOLVH]XQHVROXWLRQG¶HDX savonneuse ou de vinaigre et d’eau. Rincez à l’eau claire et séchez avec un chiffon doux. Barre supérieure avant 3RVLWLRQG¶H[WHQVLRQ maximale Saisir ici 3 2 1 3ODQFKHU 12 49-2003957 Rev. 0 Papier d'aluminium et protections pour four Directives relatives aux ustensiles de cuisson ATTENTION Ne recouvrez pas la sole du four de papier d'aluminium ni de protection pour four d'aucune sorte. Ils sont susceptibles de retenir la chaleur ou de fondre, ce qui pourrait endommager le produit ou provoquer un choc électrique, de la fumée ou un incendie. Les dommages résultant d'une utilisation inappropriée de ces articles ne sont pas couverts par la garantie du produit. 2QSHXWXWLOLVHUGXSDSLHUG DOXPLQLXPSRXUUHFXHLOOLUOHVpFODERXVVXUHVHQSRVDQWXQHIHXLOOHVXUXQHJULOOHLQIpULHXUHTXHOTXHV centimètres sous les aliments. N'utilisez pas plus de papier qu'il n'en faut et ne couvrez jamais entièrement une grille de four DYHFGXSDSLHUG DOXPLQLXP3ODFH]OHSDSLHUG DOXPLQLXPjDXPRLQVSR FP GHVSDURLVGXIRXUDILQG pYLWHUXQH mauvaise circulation de la chaleur. /HPDWpULHOOHILQLHWODWDLOOHGHO XVWHQVLOHGHFXLVVRQRQW une incidence sur le rendement de la cuisson. /HVFDVVHUROHVIRQFpHVUHFRXYHUWHVG XQHQGXLWHWPDWHV absorbent plus de chaleur que les casseroles minces et EULOODQWHV/HVFDVVHUROHVTXLDEVRUEHQWSOXVIDFLOHPHQWOD chaleur produisent des croûtes brunes, croustillantes et plus épaisses. Si vous utilisez des ustensiles de cuisson foncés et recouverts d'un enduit, vérifiez la cuisson avant le temps prescrit dans la recette. Si vous obtenez de mauvais résultats avec ce type d'ustensile de cuisson, réduisez la température du four de 25 °F (14 °C) la prochaine fois. /HVFDVVHUROHVOXVWUpHVSHUPHWWHQWGHFXLUHXQLIRUPpPHQW OHVDOLPHQWVFRPPHOHVJkWHDX[HWOHVELVFXLWV /HVFDVVHUROHVHQYHUUHRXHQFpUDPLTXHVHUpFKDXIIHQW lentement, mais conservent la chaleur plus longtemps. Ces types d'ustensiles de cuisson conviennent parfaitement aux tartes et croustades. /HVXVWHQVLOHVGHFXLVVRQLVROpVVHUpFKDXIIHQWOHQWHPHQW et peuvent réduire le brunissement des aliments. Gardez les ustensiles de cuisson propre pour favoriser une cuisson uniforme. /HVXVWHQVLOHVGHFXLVVRQXWLOLVpVDYHFOHVPRGHVGHJULOHWGH IULWXUHjFRQYHFWLRQGRLYHQWrWUHDSSURXYpVjFHWHIIHW UTILISATION DE L’APPAREIL : 3DSLHUG DOXPLQLXP'LUHFWLYHVUHODWLYHVDX[XVWHQVLOHVGHFXLVVRQ 49-2003957 Rev. 0 13 Modes de cuisson UTILISATION DE L’APPAREIL : 0RGHVGHFXLVVRQ Votre nouveau four offre une variété de modes de cuisson pour vous aider à obtenir les meilleurs résultats. Ces modes sont décrits ci-dessous. Reportez-vous à la section « Guide de cuisson » pour obtenir des recommandations spécifiques à chaque type d’aliments, et consultez le menu des options de cuisson sur l’affichage de l’appareil pour des conseils de cuisson et d’autres recommandations lors du réglage d’un mode de cuisson. N’oubliez pas que votre nouveau four peut fonctionner différemment de celui qu’il remplace. Modes de cuisson et de rôtissage Sélectionnez un mode de cuisson et de rôtissage selon le type et la TXDQWLWpG¶DOLPHQWVTXHYRXVSUpSDUH]/RUVTXHYRXVSUpSDUH]GHV SURGXLWVGHERXODQJHULHWHOVTXHJkWHDX[ELVFXLWVHWSkWLVVHULHV préchauffez toujours le four d’abord. Suivez les recommandations de la recette pour la position des aliments. En l’absence de recommandations, centrez les aliments dans le centre du four. Bake (cuisson) /HPRGHGHFXLVVRQWUDGLWLRQQHOOHHVWGHVWLQpjODFXLVVRQVXU une seule grille. Ce mode de cuisson utilise essentiellement la chaleur produite par l'élément inférieur, mais également celle générée par l'élément supérieur, pour cuire les aliments. 3RXUXWLOLVHUFHPRGHSUHVVH] Bake , entrez une température, puis pressez Start /HSUpFKDXIIDJHHVWJpQpUDOHPHQW recommandé lors de l'utilisation de ce mode. Cuisson par convection sur plusieurs grilles (sur certains modèles/four) /HPRGHGHFXLVVRQSDUFRQYHFWLRQVXUSOXVLHXUVJULOOHV &RQYHFWLRQ%DNH0XOWL5DFN HVWGHVWLQpjXQHFXLVVRQ simultanée sur plusieurs grilles. Ce mode utilise surtout la chaleur de l’élément arrière mais aussi celle des éléments VXSpULHXUHWLQIpULHXUGHPrPHTX¶XQPRXYHPHQWG¶DLUGX ventilateur de convection afin d’améliorer l’uniformité de la cuisson. Votre four est équipé de la fonction de conversion GHUHFHWWHDXWRPDWLTXH $XWR5HFLSH&RQYHUVLRQ GHVRUWH qu’il n’est pas nécessaire de convertir la température lorsque YRXVXWLOLVH]FHPRGH/¶XWLOLVDWLRQGHSOXVLHXUVJULOOHVSOXW{W qu’une seule peut légèrement prolonger le temps de cuisson. 3RXUXWLOLVHUFHPRGHSUHVVH] Convection Bake Multi Rack (cuisson par convection sur plusieurs grilles) , entrez une température, puis pressez Start 3UpFKDXIIH]WRXMRXUVOHIRXU lorsque vous utilisez ce mode. Rôtissage par convection (sur certains modèles/four) /HPRGH&RQYHFWLRQ5RDVW U{WLVVDJHSDUFRQYHFWLRQ HVW conçu pour rôtir des viandes et des légumes sur une seule grille. Ce mode utilise la chaleur des éléments inférieur, supérieur et arrière, ainsi que le mouvement de l’air, afin d’améliorer le brunissage et de réduire le temps de cuisson. ,OQ¶HVWSDVQpFHVVDLUHGHFRQYHUWLUODWHPSpUDWXUH9pULILH] les aliments plus tôt que ce que la recette suggère, ou utilisez ODVRQGH3RXUXWLOLVHUFHPRGHSUHVVH] Convection Roast (rôtissage par convection), entrez une température, puis pressez Start /HSUpFKDXIIDJHQ¶HVWSDVQpFHVVDLUHDYHFFH mode. Modes de grillage (Broil) Grillez toujours avec la porte fermée. /¶pOpPHQWGHJULOODJH de ce four est très puissant. Surveillez les aliments étroitement ORUVTXHYRXVOHVJULOOH]8VH]GHSUXGHQFHORUVGXJULOODJH sur les positions de grille supérieures car approcher les aliments de l'élément de grillage augmente la fumée, les éclaboussements et la possibilité d’enflammer la graisse. Commencez par des aliments que vous avez l’habitude de griller. Réglez les positions de grille pour ajuster l’intensité de ODFKDOHXUVXUO¶DOLPHQW3ODFH]O¶DOLPHQWSOXVSUqVGHO¶pOpPHQW de grillage lorsqu’une surface plus grillée ou un intérieur plus FXLWHVWVRXKDLWp/HVDOLPHQWVSOXVpSDLVHWFHX[TX¶LOIDXW bien cuire de part en part doivent se rôtir sur une position de grille plus éloignée de l’élément de grillage, ou il faut utiliser OHVPRGHV7UDGLWLRQDO%URLO/RRX&RQYHFWLRQ%URLO/R3RXUXQ meilleur résultat, centrez l’aliment en dessous de l’élément de JULOODJH/HJULOODJHVXUODSRVLWLRQGHJULOOHVXSpULHXUHQ¶HVWSDV recommandé. Broil (gril) /HPRGHGHJULOODJHKDXWHWHPSpUDWXUHXWLOLVHXQHFKDOHXU intense de l’élément supérieur pour brunir les aliments. 8WLOLVH]%URLO+LJKSRXUOHVFRXSHVGHYLDQGHSOXVPLQFHVHW ou les aliments que vous préférez moins cuits à l’intérieur. 3RXUXWLOLVHUFHPRGHSUHVVH] Broil (gril) , puis sélectionnez High (élevé) ou Low (faible) selon le niveau de saisie et la température interne souhaités. puis pressez Start /H préchauffage n’est pas nécessaire avec ce mode. 14 49-2003957 Rev. 0 Modes de cuisson (suite) UTILISATION DE L’APPAREIL : 0RGHVGHFXLVVRQ Friture à convection (sur certains modèles/four) /DIULWXUHjDLUFKDXG $LU)U\ HVWXQPRGHGHFXLVVRQSDU convection spécial, sans préchauffage, conçu pour donner aux aliments un surface extérieure plus croustillante par rapport jODFXLVVRQDXIRXUWUDGLWLRQQHOOH/HPRGH$LU)U\HVWFRQoX pour une cuisson sur un seule grille. Sélectionnez Air Fry , entrez la température désirée et pressez Start . Vous pouvez UpJOHUODWHPSpUDWXUHHQWUH)HW)/HSUpFKDXIIDJH n’est pas recommandé pour ce mode. Suivez la recette pour four traditionnelle ou les instructions de l’emballage pour choisir les températures et les temps de cuisson; ajustez le temps de cuisson pour obtenir la croustillance désirée. Des conseils supplémentaires pour ce mode figurent dans le guide de cuisson. Proof (fermentation) /HPRGH3URRI IHUPHQWDWLRQ HVWFRQoXSRXUIDLUHOHYHU IHUPHQWHU OHVSkWHVjSDLQ6pOHFWLRQQH] Proof (fermentation) , puis appuyez sur Start &RXYUH]ELHQODSkWHSRXUpYLWHUTX HOOH QHVqFKH/HSDLQOqYHUDSOXVUDSLGHPHQWTX jWHPSpUDWXUH ambiante. Maintien au chaud /HPRGH:DUP PDLQWLHQDXFKDXG HVWGHVWLQpjFRQVHUYHUOD température des aliments cuits pendant une durée maximale GHKHXUHV3RXUXWLOLVHUFHPRGHVpOHFWLRQQH] Warm (tenue au chaud) , puis appuyez sur Start (démarrer) . Recouvrez les aliments qu’il faut maintenir humides sauf ceux que l’on souhaite FURXVWLOODQWV/HSUpFKDXIIDJHQ¶HVWSDVQpFHVVDLUH1¶XWLOLVH] pas Warm pour réchauffer les aliments froids à l’exception GHVFUDTXHOLQVGHVFURXVWLOOHVHWGHVFpUpDOHVVqFKHV2Q recommande aussi de ne pas garder les aliments au chaud durant plus de 2 heures. Precision Cooking (cuisson de précision) (sur certains modèles/four) /DFXLVVRQGHSUpFLVLRQHVWXQHH[SpULHQFHGHFXLVVRQJXLGpH conçue pour vous offrir les meilleurs résultats de votre four SRXUGHVDOLPHQWVVSpFLILTXHV/RUVTXHYRXVVpOHFWLRQQH] XQDOLPHQWGDQVOHPHQX3UHFLVLRQ&RRNLQJOHVUpJODJHV recommandés du four pour cet aliment sont automatiquement choisis et des renseignements supplémentaires vous sont fournis afin de vous aider à obtenir le meilleur résultat possible. Des programmes supplémentaires seront disponibles via des mises à jour logicielles. Connectez votre four pour avoir accès à ces mises à jour. Consultez la section sur la connexion au Wi-Fi pour plus de détails sur la façon de connecter votre four. 49-2003957 Rev. 0 15 Modes de cuisson UTILISATION DE L’APPAREIL : 0RGHVGHFXLVVRQ 8QHIRLVTXHYRXVVpOHFWLRQQH]XQPRGHGHFXLVVRQWUDGLWLRQQHORXXQPRGH3UHFLVLRQ&RRNLQJOHVRSWLRQVGHFXLVVRQV¶DIILFKHQW sur la partie gauche de l’écran et les informations concernant vos sélections s’affichent sur la partie droite de l’écran. 1. OPTIONS DE CUISSON 8QHRSWLRQGHFXLVVRQQHV¶DIILFKHTXHVLHOOHHVWGLVSRQLEOH ou requise pour le mode de cuisson sélectionné. Si une option de cuisson n’est pas affichée pour un mode de cuisson sélectionné, cela signifie qu’elle n’est pas disponible ou qu’elle n’est pas requise. Notez que toute option de cuisson affichée pour un mode de cuisson aura des sélections par défaut, mais assurez-vous que les réglages et sélections par défaut correspondent à vos entrées souhaitées (comme la température réglée, la durée de cuisson, la taille ou le type) et au résultat attendu (degré de cuisson). Ceci est particulièrement important lors de l’utilisation des modes de cuisson de précision. $VVXUH]YRXVGHIDLUHGpILOHUYHUVOHKDXWHWYHUVOHEDVSRXU voir toutes les options de cuisson disponibles pour un mode de cuisson sélectionné. Température /RUVTXHYRXVVpOHFWLRQQH]XQHWHPSpUDWXUHGHFRQVLJQHGX four, des températures prédéfinies sont affichées et peuvent rWUHVpOHFWLRQQpHVHQIDLVDQWGpILOHUKRUL]RQWDOHPHQWHWHQ choisissant la température désirée. /¶RSWLRQSHUPHWWDQWGHUpJOHUXQHWHPSpUDWXUHGHFXLVVRQ personnalisée est disponible à l’aide du clavier numérique. 7RXVOHVPRGHVGHFXLVVRQGHSUpFLVLRQQHQpFHVVLWHQWSDV que vous régliez une température de cuisson. Minuterie Si le mode de cuisson sélectionné prend en charge une minuterie de cuisson, cette option vous permet de régler une PLQXWHULHGHFRPSWHjUHERXUVTXLSHXWrWUHSURJUDPPpHSRXU éteindre ou non le mode de cuisson à la fin du temps écoulé. Certains modes de cuisson de précision ont une minuterie qui VHUqJOHDXWRPDWLTXHPHQW'DQVFHVFDVO¶RSWLRQ0LQXWHULHQH s’affiche pas. Dans ce cas, le compte à rebours de la minuterie commence après avoir appuyé sur Start . Cette minuterie n’éteindra pas le four à la fin du temps écoulé. Sonde &HWWHRSWLRQV¶DIILFKHVLODVRQGHGXIRXUSHXWrWUHXWLOLVpHDYHF un mode de cuisson traditionnel. Consultez la section Sonde pour plus de détails sur l’utilisation de la sonde du four. Certains modes de cuisson de précision exigent l’utilisation GHODVRQGHGHIRXUIRXUQLHDYHFOHIRXU3RXUFHVF\FOHVGHV instructions de placement de la sonde sont fournies, mais la température de consigne de la sonde est déterminée par le PRGHGHFXLVVRQ3UHFLVLRQVpOHFWLRQQp Cooking Mode Start 1:59 PM 2SWLRQVGHFXLVVRQ Réglage rapide de la teinte Barre de navigation Barre d’état Clavier numérique ,QIRUPDWLRQVRXVpOHFWLRQV 3. Réglage d’un mode de cuisson À partir de l’écran d’accueil, sélectionnez le four lorsque vous utilisez un four double. Sélectionnez ensuite le mode de Traditional Cooking (cuisson traditionnelle) ou Precision Cooking (cuisson de précision) . 6LYRXVVpOHFWLRQQH]3UHFLVLRQ&RRNLQJ FXLVVRQGHSUpFLVLRQ les catégories s’afficheront sur la partie gauche de l’écran et les options d’aliments s’afficheront sur la partie droite. 1. Catégories : /HVDOLPHQWVVRQWUHJURXSpVHQFDWpJRULHV Faites défiler vers le haut ou vers le bas pour voir toutes les catégories. Sélectionnez une catégorie pour afficher toutes les options d’aliments de cette catégorie sur le côté droit de l’écran. 2. Aliments : Faites défiler vers la gauche ou la droite pour voir toutes les options d’aliments d’une catégorie. Sélectionnez un aliment sur le côté droit de l’écran pour commencer la cuisson. D’autres catégories et options d’aliments seront offertes lors de mises à jour logicielles. Connectez votre four pour avoir accès à ces mises à jour. Consultez la section Wi-Fi Connectivity (connectivité Wi-Fi) pour savoir comment connecter votre four.. 1. Catégories $OLPHQWV Precision Cooking 1:59 PM 16 49-2003957 Rev. 0 Modes de cuisson (suite) UTILISATION DU FOUR : 0RGHVGHFXLVVRQ Réglage d’un mode de cuisson 1. OPTIONS DE CUISSON (suite) Conseils de cuisson Cette option fournit des renseignements utiles adaptés au mode de cuisson sélectionné. Cela peut inclure des conseils sur la préparation des aliments, l’influence des ustensiles de FXLVVRQVXUOHVUpVXOWDWVRXGHVDVWXFHVSRXUpYLWHUOHVGpJkWV dans la cavité du four. Grille et ustensiles de cuisson 3RXUFHUWDLQVPRGHV3UHFLVLRQFHWWHRSWLRQGRQQHGHV suggestions sur l’emplacement de la grille et les ustensiles de cuisson à utiliser selon le mode sélectionné. Nombre de grilles 3RXUFHUWDLQVPRGHV3UHFLVLRQ SDUH[HPSOHOHVSURGXLWVGH boulangerie comme les biscuits), cette option propose des choix de cuisson sur une seule grille ou sur plusieurs grilles. Si cette option n’est pas affichée, il est prévu que vous cuisiniez sur une seule grille. Degré de cuisson 3RXUFHUWDLQVPRGHV3UHFLVLRQ FRPPHOHVVWHDNVRXOH bacon), cette option exige que vous choisissiez le degré de cuisson désiré pour l’aliment sélectionné. Certains aliments avec des options de degré de cuisson nécessitent la sonde, tandis que d’autres se basent sur la durée de cuisson. /RUVTX¶XQGHJUpGHFXLVVRQHVWVpOHFWLRQQpODFLEOHGHOD sonde ou la durée de cuisson, ainsi que les conditions de cuisson du four, sont ajustées selon l’aliment choisi. Taille 3RXUFHUWDLQVPRGHV3UHFLVLRQ FRPPHOHVDXPRQ FHWWH option exige que vous choisissiez parmi une liste de sélections afin d’adapter les conditions de cuisson et la durée en fonction des choix effectués. Type 3RXUFHUWDLQVPRGHV3UHFLVLRQ FRPPHOHEDFRQ FHWWHRSWLRQ exige que vous choisissiez parmi une liste de sélections (par exemple, épais, régulier ou coupe centrale pour le bacon) afin d’adapter les conditions de cuisson et la durée en fonction des choix effectués. 2. INFORMATIONS OU SÉLECTIONS /HFRQWHQXGHFHWWH]RQHYDULHVHORQO¶RSWLRQDFWLYH VpOHFWLRQQpHjJDXFKH$VVXUH]YRXVGHIDLUHJOLVVHUYHUVOD gauche et la droite dans cette zone pour voir tout le contenu SHUWLQHQW,OSHXW\DYRLUGHVUHFRPPDQGDWLRQVG¶XVWHQVLOHVGH cuisson ou des conseils supplémentaires à consulter. 3. DÉMARRER Vérifiez les réglages des options de cuisson, vos sélections et placez la ou les grilles du four avant d’appuyer sur Start (démarrer). 49-2003957 Rev. 0 17 Sonde thermique (sur certains modèles) /DWHPSpUDWXUHLQWHUQHGHO¶DOLPHQWHVWIUpTXHPPHQWXWLOLVpHFRPPHLQGLFDWHXUGHFXLVVRQDGpTXDWHHQSDUWLFXOLHUSRXUOHV U{WLVHWODYRODLOOH/DVRQGHPHVXUHODWHPSpUDWXUHLQWHUQHGHVDOLPHQWVHWpWHLQWOHIRXUORUVTXHFHOXLFLDWWHLQWODWHPSpUDWXUH programmée. AVERTISSEMENT Consommer des aliments insuffisamment cuits peut entraîner une maladie d'origine alimentaire. Utilisez la sonde thermique en suivant les instructions suivantes pour vous assurer que toutes les parties de l'aliment atteignent une température de cuisson sécuritaire minimale. Les recommandations concernant la température minimale sécuritaire des aliments sont fournies par le USDA et la FDA. Vérifiez toujours la température à plusieurs endroits dans l'aliment à l'aide d'un thermomètre pour aliment afin de vous assurer que toutes les portions de l'aliment ont atteint la température interne souhaitée. Positionnement de la sonde thermique $SUqVDYRLUSUpSDUpODYLDQGHHWO DYRLUSODFpHVXU l'ustensile de cuisson, suivez ces consignes pour placer la sonde correctement. Ŷ ,QVpUH]ODVRQGHGDQVO DOLPHQWGHPDQLqUHjFHTXH sa pointe soit positionnée au centre de la partie la plus pSDLVVHGHO DOLPHQW3RXUGHVSHUIRUPDQFHVRSWLPDOHV ODVRQGHGRLWrWUHHQWLqUHPHQWLQVpUpHGDQVODQRXUULWXUH Si la sonde n'est pas placée correctement, elle pourrait ne pas mesurer avec précision la température de la partie la plus froide de l'aliment. Certains aliments, en particulier les aliments de faibles dimensions, ne sont pas bien adaptés pour la cuisson avec la sonde en raison de leur forme ou de leur taille. Ŷ /DVRQGHQHGRLWWRXFKHUQLRVQLJUDVQLFDUWLODJH Ŷ 3RXUXQHYRODLOOHHQWLqUHLQVpUH]ODVRQGHGDQVODSDUWLH la plus épaisse de la poitrine. Ŷ 3RXUXQU{WLGpVRVVpLQVpUH]ODVRQGHGDQVOHFHQWUH du rôti. Ŷ 3RXUXQMDPERQRXGHO DJQHDXDYHFRVLQVpUH]ODVRQGH au centre du grand muscle ou de l'articulation la plus basse. Ŷ 3RXUXQPHWVHQFRFRWWHFRPPHOHSDLQGHYLDQGHLQVpUH] la sonde dans le centre de l'aliment. Ŷ 3RXUOHSRLVVRQLQVpUH]ODVRQGHMXVWHDXGHVVXVGHOD branchie et dans la partie la plus charnue, parallèlement à la colonne vertébrale. Utilisation de la sonde thermique Utilisation de la sonde: ,QVpUH]ODVRQGHGDQVO DOLPHQW UHSRUWH]YRXVjODVHFWLRQ ©3RVLWLRQQHPHQWGHODVRQGHWKHUPLTXHª 3ODFH]O DOLPHQWGDQVOHIRXUHWEUDQFKH]ODVRQGHGDQV sa prise à l'intérieur du ou des fours. REMARQUE : /D VRQGHQHSHXWSDVrWUHXWLOLVpHSHQGDQWOHVPRGHVEURLO (griller), convection broil (griller par convection), dehydrate GpVK\GUDWHU ZDUP UpFKDXIIHU SURRI OHYpH 3. Sélectionnez le mode et la température de cuisson désirés. Si le mode de cuisson prend en charge l’utilisation d’une VRQGHODIHQrWUHGHUpJODJHGHODVRQGHDSSDUDvWUD(QWUH] le température d’aliment désirée et pressez Start . Vous pouvez régler la température de la sonde entre 100°F et 200°F. REMARQUE : Si vous souhaitez préchauffer, effectuez cette étape avant l’étape 1. /HVPRGHVGHFXLVVRQWUDGLWLRQQHOV jO¶H[FHSWLRQGH6ORZ Roast) mettent fin au mode lorsque la température de la VRQGHHVWDWWHLQWHWDQGLVTXHOHVPRGHV3UHFLVLRQ&RRNLQJ ne le font pas. Consignes d'entretien de la sonde thermique REMARQUE : Certains modèles à deux fours sont munis d’une sonde dans le four supérieur seulement. Ŷ /¶XWLOLVDWLRQGHVRQGHVGLIIpUHQWHVGHFHOOHIRXUQLHDYHFFH produit risque d’endommager la sonde. Ŷ 8WLOLVH]OHVSRLJQpHVGHODVRQGHHWGHODILFKHORUVTXH vous les insérez dans la viande/la prise ou les en retirez. Ŷ 1HUHWLUH]SDVODVRQGHGHO DOLPHQWRXGHODSULVHHQWLUDQW VXUVRQFkEOHDXPR\HQG XQHSLQFH9RXVULVTXHULH]GH l'endommager. Ŷ 3RXUpYLWHUGHFDVVHUODVRQGHDVVXUH]YRXVTXHO DOLPHQW est complètement décongelé avant d'insérer la sonde. Ŷ 3RXUpYLWHUOHVEUOXUHVQHGpEUDQFKH]SDVODVRQGH de la prise avant que le four n'ait refroidi. Ŷ 1HODLVVH]MDPDLVODVRQGHjO LQWpULHXUGXIRXUSHQGDQW l'autonettoyage ou le nettoyage à la vapeur. Ŷ 1HUDQJH]SDVODVRQGHGDQVOHIRXU UTILISATION DE L’APPAREIL : Sonde thermique 18 49-2003957 Rev. 0 Guide de cuisson - Four supérieur TYPE D'ALIMENT MODES DE CUISSON RECOMMANDÉS POSITIONS DE GRILLE RECOMMANDÉES SUGGESTIONS ADDITIONNELLES Produits de boulangerie et pâtisseries *kWHDX[jpWDJHVJkWHDX[SODWV JkWHDX[%XQGWPXIILQV Cuisson traditionnelle 1 8WLOLVH]XQXVWHQVLOHGHFXLVVRQDXILQLEULOODQW %LVFXLWVSHWLWVJkWHDX[VHFVVFRQHV Cuisson traditionnelle 1 8WLOLVH]XQXVWHQVLOHGHFXLVVRQDXILQLEULOODQW Bœuf et porc Galettes de bœuf haché Gril élevé 1 8WLOLVH]XQHOqFKHIULWHDEDLVVH]OHVDOLPHQWVGDQVOHIRXUSRXUXQHFXLVVRQ plus en profondeur/moins grillée. Vérifiez fréquemment les aliments lorsque YRXVXWLOLVH]ODFXLVVRQDXJULO3RXUGHPHLOOHXUVUpVXOWDWVSODFH]O DOLPHQWDX centre du four, sous l'élément de gril. %LIWHFNVHWF{WHOHWWHV Gril élevé 1 8WLOLVH]XQHOqFKHIULWHDEDLVVH]OHVDOLPHQWVGDQVOHIRXUSRXUXQHFXLVVRQ plus en profondeur/moins grillée. Vérifiez fréquemment les aliments lorsque YRXVXWLOLVH]ODFXLVVRQDXJULO3RXUGHPHLOOHXUVUpVXOWDWVSODFH]O DOLPHQWDX centre du four, sous l'élément de gril. Volaille 3RLWULQHVGHSRXOHWDYHFRVFXLVVHV pilons Cuisson traditionnelle Gril bas 1 Vérifiez fréquemment les aliments lorsque vous utilisez la cuisson au gril. 3RXUGHPHLOOHXUHVSHUIRUPDQFHVORUVGHODFXLVVRQDXJULOFHQWUH]OHV aliments sous l'élément chauffant du gril. 3RLWULQHVGHSRXOHWGpVRVVpHV Cuisson traditionnelle Gril bas 1 Vérifiez fréquemment les aliments lorsque vous utilisez la cuisson au gril. 3RXUGHPHLOOHXUHVSHUIRUPDQFHVORUVGHODFXLVVRQDXJULOFHQWUH]OHV aliments sous l'élément chauffant du gril. Poisson Gril bas 1 Vérifiez fréquemment les aliments lorsque vous utilisez la cuisson au gril. 3RXUGHPHLOOHXUHVSHUIRUPDQFHVORUVGHODFXLVVRQDXJULOFHQWUH]OHV aliments sous l'élément chauffant du gril. Mets mijotés Cuisson traditionnelle 1 Aliments préparés surgelés 3L]]D Cuisson traditionnelle 1 8WLOLVH]XQXVWHQVLOHGHFXLVVRQDXILQLEULOODQW 3URGXLWVGHSRPPHVGHWHUUHFURTXHWWHV de poulet, hors-d'œuvre Cuisson traditionnelle 1 8WLOLVH]GHVXVWHQVLOHVGHFXLVLQHDXILQLEULOODQWORUVTXHYRXVXWLOLVH]OD cuisson traditionnel /HWDEOHDXFLGHVVRXVIRXUQLWFHUWDLQHVOLJQHVGLUHFWULFHVSRXUOHVPRGHVGHFXLVVRQKDELWXHOV /HVUHFRPPDQGDWLRQVPLQLPDOHVGHWHPSpUDWXUHVpFXULWDLUHGHVDOLPHQWVVRQWIRXUQLHVSDUO¶86'$HWOD)'$8WLOLVH]XQWKHUPRPqWUHDOLPHQWDLUHSRXU mesurer la température des aliments et vérifiez à plusieurs endroits. UTILISATION DE L’APPAREIL : Guide de cuisson - Four supérieur 49-2003957 Rev. 0 19 Guide de cuisson - Four inférieur TYPE D'ALIMENT MODES DE CUISSON RECOMMANDÉS POSITIONS DE GRILLE RECOMMANDÉES SUGGESTIONS ADDITIONNELLES Produits de boulangerie et pâtisseries *kWHDX[jpWDJHVJkWHDX[SODWV JkWHDX[%XQGWPXIILQVSDLQVj préparation rapide sur une seule grille Cuisson traditionnelle 1 8WLOLVH]XQXVWHQVLOHGHFXLVVRQDXILQLEULOODQW *kWHDX[jpWDJHV VXUSOXVLHXUVJULOOHV Cuisson à convection avec plusieurs grilles 3ODQFKHUHWH[W $VVXUH]XQHFLUFXODWLRQG¶DLUDGpTXDWH YRLUO¶LOOXVWUDWLRQFLGHVVRXV *kWHDX[GHVDQJHV Cuisson traditionnelle 3ODQFKHU 8WLOLVH]XQXVWHQVLOHGHFXLVVRQDXILQLEULOODQW Biscuits, pains cuits en galettes sur une seule grille Cuisson traditionnelle 1 8WLOLVH]XQXVWHQVLOHGHFXLVVRQDXILQLEULOODQW Biscuits, pains cuits en galettes sur plusieurs grilles Cuisson à convection avec plusieurs grilles 3ODQFKHUHWH[W $VVXUH]XQHFLUFXODWLRQG DLUDGpTXDWH Bœuf et porc Galettes de bœuf haché Gril élevé 2 8WLOLVH]XQHOqFKHIULWHDEDLVVH]OHVDOLPHQWVGDQVOHIRXUSRXUXQHFXLVVRQ plus en profondeur/moins grillée. Vérifiez fréquemment les aliments lorsque YRXVXWLOLVH]ODFXLVVRQDXJULO3RXUGHPHLOOHXUVUpVXOWDWVSODFH]O DOLPHQWDX centre du four, sous l'élément de gril. %LIWHFNVHWF{WHOHWWHV Gril élevé 2 8WLOLVH]XQHOqFKHIULWHDEDLVVH]OHVDOLPHQWVGDQVOHIRXUSRXUXQHFXLVVRQ plus en profondeur/moins grillée. Vérifiez fréquemment les aliments lorsque YRXVXWLOLVH]ODFXLVVRQDXJULO3RXUGHPHLOOHXUVUpVXOWDWVSODFH]O DOLPHQWDX centre du four, sous l'élément de gril. Rôtis Cuisson traditionnelle Rôtissage à convection 3ODQFKHURXH[W Ne couvrez pas; utilisez un ustensile moins profond, comme une lèchefrite. /HSUpFKDXIIDJHQ HVWSDVQpFHVVDLUH Volaille 3RXOHWHQWLHU Cuisson traditionnelle Rôtissage à convection 3ODQFKHURXH[W 8WLOLVH]XQXVWHQVLOHGHFXLVVRQSHXSURIRQGFRPPHXQHOqFKHIULWH/H préchauffage n'est pas nécessaire. 3RLWULQHVGHSRXOHWDYHFRVFXLVVHV pilons Gril bas Cuisson traditionnelle Rôtissage à convection 1 Grillez d'abord avec la peau vers le bas. Vérifiez fréquemment les aliments ORUVTXHYRXVXWLOLVH]ODFXLVVRQDXJULO3RXUGHPHLOOHXUHVSHUIRUPDQFHVORUV de la cuisson au gril, centrez les aliments sous l'élément chauffant du gril. 3RLWULQHVGHSRXOHWGpVRVVpHV Gril bas Cuisson traditionnelle Rôtissage à convection 1 $EDLVVH]OHVDOLPHQWVGDQVOHIRXUSRXUXQHFXLVVRQSOXVHQSURIRQGHXU moins grillée, et disposez-les plus haut dans le four pour les griller et les EUXQLUGDYDQWDJH3RXUGHPHLOOHXUHVSHUIRUPDQFHVORUVGHODFXLVVRQDXJULO centrez les aliments sous l'élément chauffant du gril. Dinde entière Cuisson traditionnelle Rôtissage à convection 3ODQFKHU 8WLOLVH]XQXVWHQVLOHGHFXLVVRQSHXSURIRQGFRPPHXQHOqFKHIULWH /HSUpFKDXIIDJHQ HVWSDVQpFHVVDLUH 3RLWULQHGHGLQGH Cuisson traditionnelle Rôtissage à convection 3ODQFKHURXH[W 8WLOLVH]XQXVWHQVLOHGHFXLVVRQSHXSURIRQGFRPPHXQHOqFKHIULWH /HSUpFKDXIIDJHQ HVWSDVQpFHVVDLUH Poisson Gril bas 1 ou 2 Vérifiez fréquemment les aliments lorsque vous utilisez la cuisson au gril. 3RXUGHPHLOOHXUVUpVXOWDWVSODFH]O DOLPHQWDXFHQWUHGXIRXUVRXVO pOpPHQW de gril. Mets mijotés Cuisson traditionnelle 1 Aliments préparés surgelés 3L]]DVXUXQHVHXOHJULOOH Cuisson traditionnelle 1 8WLOLVH]XQXVWHQVLOHGHFXLVVRQDXILQLEULOODQW 3L]]DVVXUSOXVLHXUVJULOOHV Cuisson à convection avec plusieurs grilles 3ODQFKHUHWH[W 8WLOLVH]XQXVWHQVLOHGHFXLVVRQDXILQLEULOODQW 3URGXLWVGHSRPPHVGH terre, croquettes de poulet, hors-d'œuvre sur une seule grille Cuisson traditionnelle 1 8WLOLVH]GHVXVWHQVLOHVGHFXLVLQHDXILQLEULOODQWORUVTXHYRXVXWLOLVH]OD cuisson traditionnel 3URGXLWVGHSRPPHVGHWHUUH croquettes de poulet, hors-d'œuvre sur plusieurs grilles Cuisson à convection avec plusieurs grilles 3ODQFKHUHWH[W 8WLOLVH]XQXVWHQVLOHGHFXLVVRQDXILQLEULOODQW'pSODFH]OpJqUHPHQWOHV aliments pendant la cuisson pour garantir une cuisson uniforme. /HWDEOHDXFLGHVVRXVIRXUQLWFHUWDLQHVOLJQHVGLUHFWULFHVSRXUOHVPRGHVGHFXLVVRQKDELWXHOV /HVUHFRPPDQGDWLRQVPLQLPDOHVGHWHPSpUDWXUHVpFXULWDLUHGHVDOLPHQWV VRQWIRXUQLHVSDUO¶86'$HWOD)'$8WLOLVH]XQWKHUPRPqWUHDOLPHQWDLUH pour mesurer la température des aliments et vérifiez à plusieurs endroits. /RUVTXHYRXVIDLWHVFXLUHTXDWUHFRXFKHVGHJkWHDXjODIRLVXWLOLVH]OD grille du bas et la grille d’extension sur 2 dans la cavité inférieure. Centrez les moules d’avant en arrière sur les grilles comme illustré. Grille de plancher UTILISATION DE L’APPAREIL : Guide de cuisson - Four inférieur 20 49-2003957 Rev. 0 Guide de cuisson Guide de friture à convection /HPRGHGHIULWXUHjFRQYHFWLRQHVWXQPRGHGHFXLVVRQ à convection sans préchauffage conçu pour obtenir un extérieur plus croustillant que la cuisson au four traditionnelle. Sélectionnez Air Fry (Friture à convection) puis sélectionnez la température de réglage désirée et appuyez sur Start (mise en marche) /DWHPSpUDWXUHSHXWrWUHUpJOpHHQWUH)HW 500 °F. Directives pour les ustensiles de friture à convection 8WLOLVH]VHXOHPHQWGHVXVWHQVLOHVGHFXLVVRQDSSURXYpVSRXU le gril lorsque vous utilisez le mode de friture à convection. /¶XWLOLVDWLRQG¶XQHSODTXHjSkWLVVHULHIRQFpHHVW UHFRPPDQGpH8QHSODTXHIRQFpHSHUPHWWUDG¶REWHQLUXQ meilleur brunissage et plus de croustillance. • Des paniers de cuisson et des grilles de cuisson au four SHXYHQWpJDOHPHQWrWUHXWLOLVpVPDLVXQHSODTXHGHFXLVVRQ GRLWrWUHSODFpHVXUODJULOOHVLWXpHVRXVOHVDOLPHQWVSRXU récupérer les gouttes provenant de la cuisson des aliments. Conseils généraux pour le mode de friture à convection (Air Fry) /HPRGHGHIULWXUHjFRQYHFWLRQHVWFRQoXSRXUXQHFXLVVRQ sur une seule grille /HPRGHGHIULWXUHjFRQYHFWLRQ $LU)U\ HVWFRQoXSRXUrWUH utilisé sans préchauffage. /DSRVLWLRQGHODJULOOHHVWUHFRPPDQGpHSRXUODSOXSDUWGHV aliments. Si les aliments brunissent trop rapidement, essayez d’utiliser la position inférieure de la grille. /HVDOLPHQWVSHXYHQWFXLUHSOXVUDSLGHPHQWTXHSUpYXVLOH four est déjà chaud lorsque vous insérerez des aliments dans le four. /RUVTXHYRXVIDLWHVIULUHGHVDOLPHQWVjFRQYHFWLRQDYHFGHOD sauce, il est recommandé de badigeonner la sauce à la fin de la cuisson. • Si les aliments brunissent trop rapidement, essayez la position inférieure de la grille ou abaissez le réglage de température. 3RXUOHVDOLPHQWVHPEDOOpVVXLYH]OHVLQVWUXFWLRQVGHFXLVVRQ au four traditionnel pour régler la température et la durée de cuisson prévues. ,OQ¶HVWSDVQpFHVVDLUHGHUHWRXUQHURXGHUHPXHUOHVDOLPHQWV pendant la cuisson. • Disposez les aliments en une seule couche sur la plaque VDQVWRXWHIRLVODVXUFKDUJHU3RXUGHPHLOOHXUVUpVXOWDWVOHV aliments ne doivent pas se chevaucher. • Faites bien cuire les aliments pour aider à prévenir les PDODGLHVG¶RULJLQHDOLPHQWDLUH/HVUHFRPPDQGDWLRQVGH température minimale sécuritaire pour les aliments sont IRXUQLHVSDUOH86'$HWOD)'$8WLOLVH]XQWKHUPRPqWUH alimentaire pour mesurer la température des aliments et vérifiez à plusieurs endroits. ALIMENTS POSITION DE GRILLE RECOMMANDÉE RÉGLAGES DE TEMPÉRATURE RECOMMANDÉES (°F) DURÉE DE CUISSON RECOMMANDÉE (MIN.) REMARQUES 3RLVVRQIUDLVVDQVDUrWHVRX morceaux de volaille, panés comme des pépites, filets, EkWRQQHWV Coulissante 2 375 à 400 15 à 30 8WLOLVH]OHVUpJODJHVGHWHPSpUDWXUHOHVSOXV EDVSRXUOHVSOXVJURVPRUFHDX[8WLOLVH]GHV ustensiles de cuisson brillants $LOHVGHSRXOHWVIUDvFKHV avec os Coulissante 2 375 à 400 25 à 40 Salez les ailes ou enrobez-les d’épices à frotter sèches. Si vous utilisez de la sauce, badigeonnez-la après la cuisson ou juste avant la fin. $LOHVRXFXLVVHVGHSRXOHW fraîches avec os Coulissante 2 375 à 400 30 à 55 8WLOLVH]OHVUpJODJHVGHWHPSpUDWXUHOHVSOXVEDV pour les plus gros morceaux Frites fraîches minces (< 1/2 po) Coulissante 2 400 à 425 15 à 30 Du papier parchemin est recommandé pour la SUpSDUDWLRQGHIULWHVIUDvFKHV3RXUGHVIULWHV plus croustillantes, secouez-les dans de la fécule de maïs ou de farine de riz avant la cuisson. Frites fraîches épaisses (> 1/2 po) Coulissante 2 375 à 400 20 à 35 Du papier parchemin est recommandé pour la SUpSDUDWLRQGHIULWHVIUDvFKHV3RXUGHVIULWHV plus croustillantes, secouez-les dans de la fécule de maïs ou de farine de riz avant la cuisson. $OLPHQWVFRQJHOpVHPEDOOpV Coulissante 2 Respectez les instructions de cuisson au four traditionnel (pas le mode de friture à convection) comme guide SRXUUpJOHUODWHPSpUDWXUHHWODGXUpHGHFXLVVRQ8QHGXUpHGHFXLVVRQSOXVORQJXHTXHFHOOHUHFRPPDQGpHVXU O¶HPEDOODJHSHXWrWUHQpFHVVDLUHSRXUFHUWDLQVDOLPHQWV6LOHIRXUHVWGpMjFKDXGORUVTXHYRXVFRPPDQGH]OD cuisson, les aliments peuvent cuire plus rapidement que la durée minimum indiquée sur l’emballage. 3ULQFLSDOXVWHQVLOHGHFXLVVRQUHFRPPDQGp $XWUHVRSWLRQVG XVWHQVLOHVGHFXLVVRQ UTILISATION DU FOUR : Guide de friture à convection 49-2003957 Rev. 0 21 Nettoyage du four – Extérieur $VVXUH]YRXVTXHWRXVOHVERXWRQVVRQWHQSRVLWLRQG DUUrWHWTXHWRXWHVOHVVXUIDFHVVRQWIURLGHVDYDQWGHQHWWR\HUODFXLVLQLqUH Tableau de commande 3RXUYHUURXLOOHUOHVFRPPDQGHVFRQVXOWH]OHVUHQVHLJQHPHQWVVXUOHYROHW3DUDPqWUHVUDSLGHVGDQVODVHFWLRQ5pJODJHVGH O¶DIILFKDJHGHO¶DSSDUHLO,OHVWUHFRPPDQGpGHQHWWR\HUOHWDEOHDXGHFRPPDQGHDSUqVFKDTXHXWLOLVDWLRQ1HWWR\H]OHDYHFGX savon doux et de l'eau ou un mélange de vinaigre et d'eau, rincez-le à l'eau claire et séchez-le avec un chiffon doux pour le polir. N'utilisez pas de nettoyant abrasif, de nettoyant liquide fort, de tampon à récurer en plastique ou de nettoyant pour four sur le WDEOHDXGHFRPPDQGH,OVHQGRPPDJHUDLHQWVRQUHYrWHPHQW Surfaces extérieures du four N'utilisez pas de nettoyant pour four, de nettoyant abrasif, de nettoyant liquide fort, de laine d'acier, de tampon à récurer en plastique ou de poudre à récurer pour nettoyer l'extérieur GXIRXU8WLOLVH]XQVDYRQGRX[HWGHO HDXRXXQHVROXWLRQ de vinaigre et d'eau. Rincez à l'eau claire et asséchez avec XQFKLIIRQGRX[HWSURSUH/RUVGXQHWWR\DJHGHVVXUIDFHV assurez-vous qu'elles sont à la température ambiante et qu'elles ne sont pas exposées aux rayons directs du soleil. Si une tache persiste sur les garnitures des évents, utilisez un nettoyant abrasif doux et le côté grattoir d'une éponge pour de meilleurs résultats. /HVpFODERXVVXUHVGHPDULQDGHMXVGHIUXLWVDXFHWRPDWH et jus de cuisson contiennent des éléments acides qui SHXYHQWFDXVHUXQHGpFRORUDWLRQ(OOHVGRLYHQWGRQFrWUH LPPpGLDWHPHQWHVVX\pHV/DLVVH]OHVVXUIDFHVFKDXGHV refroidir, plus nettoyez-les et rincez-les. Surfaces peintes et de couleur noire en acier inoxydable (certains modèles) /HVVXUIDFHVSHLQWHVSHXYHQWLQFOXUHODSRUWHHWODJDUQLWXUH entourant le tableau de commande. Nettoyez-les avec de l'eau et du savon ou avec une solution d'eau et de vinaigre. N'utilisez pas de nettoyant commercial pour four, de poudre nettoyante, de laine d'acier ou d'abrasif fort sur les surfaces peintes, y compris l'acier inoxydable noir. Acier inoxydable (à l'exception de l'acier inoxydable noir) (certains modèles) N'utilisez pas de tampon en laine d'acier; il raierait la surface. 3RXUQHWWR\HUODVXUIDFHHQDFLHULQR[\GDEOHXWLOLVH]GHO HDX tiède savonneuse ou un produit de nettoyage ou à polir pour acier inoxydable. Essuyez toujours la surface dans le sens du grain. Suivez les instructions du nettoyant pour surface en acier inoxydable. /HVQHWWR\DQWVFRQWHQDQWGHO DFLGHR[DOLTXHSHUPHWWHQW d'éliminer la rouille, le ternissement et les petits défauts de la VXUIDFHGXIRXU8WLOLVH]XQLTXHPHQWOHVQHWWR\DQWVOLTXLGHV sans granule et frottez dans le sens du grain avec une éponge douce et humide. 3RXUHQVDYRLUGDYDQWDJHVXUO DFKDWGHSURGXLWVGHQHWWR\DJH y compris les nettoyants pour appareils électroménagers en acier inoxydable ou les produits de polissage, consultez les VHFWLRQV©$FFHVVRLUHVªHW©6HUYLFHjODFOLHQWqOHªjODILQ de ce manuel. ENTRETIEN ET NETTOYAGE : Nettoyage du four – Extérieur 22 49-2003957 Rev. 0 Nettoyage du four – Intérieur / LQWpULHXUGHYRWUHQRXYHDXIRXUSHXWrWUHQHWWR\pjODPDLQRXHQXWLOLVDQWOHVIRQFWLRQVGHQHWWR\DJHjODYDSHXURXG DXWRQHWWR\DJH /HVpFODERXVVXUHVGHPDULQDGHMXVGHIUXLWVDXFHWRPDWHHWMXVGHFXLVVRQFRQWLHQQHQWGHVpOpPHQWVDFLGHVTXLSHXYHQWFDXVHU XQHGpFRORUDWLRQ(OOHVGRLYHQWGRQFrWUHLPPpGLDWHPHQWHVVX\pHV/DLVVH]OHVVXUIDFHVFKDXGHVUHIURLGLUSOXVQHWWR\H]OHV et rincez-les. Nettoyage manuel N'utilisez pas de nettoyant pour four (sauf si certifié pour four à autonettoyage), de nettoyant liquide fort ou de tampon à UpFXUHUjO LQWpULHXUGXIRXU8WLOLVH]XQVDYRQGRX[HWGHO HDX ou une solution de vinaigre et d'eau. Rincez à l'eau claire et DVVpFKH]DYHFXQFKLIIRQGRX[HWSURSUH$VVXUH]YRXVTXHOHV surfaces sont à la température ambiante avant de les nettoyer. Nettoyage à la vapeur /DIRQFWLRQ6WHDP&OHDQ QHWWR\DJHjODYDSHXU HVWFRQoXH pour chauffer suffisamment l’eau ajoutée au fond afin qu’elle atteigne une température permettant à la vapeur de se condenser sur les saletés alimentaires. Ce processus ramollit les résidus, ce qui facilite leur élimination. /HIRXUGRLWrWUHIURLGDYDQWGHFRPPHQFHUXQF\FOH6WHDP Clean (nettoyage à la vapeur). Cela permet d’essuyer en toute sécurité les graisses et saletés au fond du four au préalable. De plus, cela prévient le risque de choc thermique et de fissuration de l’émail pouvant résulter du versement d’eau froide sur une surface de four chaude. Versez une tasse d’eau (250 ml) dans le fond du four. Fermez la porte. Sélectionnez Steam Clean (nettoyage à la vapeur) puis appuyez sur Start (démarrer) à droite de l’écran. Vous ne devez pas ouvrir la porte pendant les 30 minutes du cycle Steam Clean (nettoyage à la vapeur), car cela réduira l’efficacité du nettoyage. Essuyez tout excès d’eau et toute saleté restante. NOTE : /¶HDXDXIRQGGXIRXUSHXWrWUHFKDXGH immédiatement après la fin du cycle. Autonettoyage /LVH]OHVLQVWUXFWLRQVUHODWLYHVjO DXWRQHWWR\DJHGXIRXU au début de ce manuel avant d'utiliser cette fonction. / DXWRQHWWR\DJHXWLOLVHGHVWHPSpUDWXUHVWUqVpOHYpHVSRXU QHWWR\HUO LQWpULHXUGXIRXU/DSRUWHGXIRXUVHYHUURXLOOH ORUVTXHFHWWHIRQFWLRQHVWDFWLYpH$YDQWGHODQFHUOH programme d'autonettoyage, essuyez la graisse et les saletés susceptibles de se trouver dans le four. Enlevez tous les éléments du four, mis à part les grilles émaillées (de couleur IRQFpH /HVVXSSRUWVGHJULOOHjILQLOXVWUpRXDUJHQWpOD sonde thermique et tout autre ustensile de cuisson, ou tout DXWUHDUWLFOHGRLYHQWrWUHUHWLUpVGXIRXUDYDQWGHODQFHUOH programme d'autonettoyage. Fermez la porte. Si vous utilisez un four double, sélectionnez le four que vous souhaitez nettoyer. Sélectionnez Self Clean (autonettoyage) . Choisissez un cycle de 3, 4 ou 5 heures, puis sélectionnez Start (mise en marche) 3RXUOHVIRXUVWUqVVDOHVLOHVWUHFRPPDQGp d’utiliser la durée maximale de 5 heures. Si vous souhaitez utiliser la durée par défaut, appuyez sur Start (mise en marche) immédiatement après avoir sélectionné Self Clean (autonettoyage) /HIRXULQGLTXHUDTXHODSRUWHHVWYHUURXLOOpH HWDIILFKHUDOHWHPSVUHVWDQWGXF\FOH$SSX\H]VXU Cancel (annuler) VLYRXVVRXKDLWH]DUUrWHUOHF\FOH/HIRXUV¶pWHLQGUD automatiquement lorsque le cycle d’autonettoyage sera WHUPLQp/DSRUWHGHPHXUHUDYHUURXLOOpHMXVTX¶jFHTXHOHIRXU DLWUHIURLGL/RUVTXHOHIRXUDUHIURLGLHVVX\H]ODFHQGUHTXLVH sera formée dans le four. Nous vous recommandons d'aérer votre cuisine en ouvrant XQHIHQrWUHRXHQXWLOLVDQWXQYHQWLODWHXURXXQHKRWWHORUVGX premier autonettoyage. /DVDOHWpVXUOHFDGUHDYDQWGXIRXUDLQVLTX jO H[WpULHXUGX MRLQWGHODSRUWHGRLWrWUHQHWWR\pHjODPDLQ1HWWR\H]FHV zones avec de l'eau chaude et des tampons en laine d'acier imbibés de savon ou des nettoyants tels que Soft Scrub 0' . Rincez bien avec de l'eau propre et séchez. 1HQHWWR\H]SDVOHMRLQW/HPDWpULDXHQILEUHGHYHUUHGXMRLQW GHODSRUWHGXIRXUQHUpVLVWHSDVjO DEUDVLRQ,OHVWHVVHQWLHO que le joint reste intact. Si vous constatez que le joint est usé ou endommagé, remplacez-le. $VVXUH]YRXVTXHOHFRXYUHDPSRXOHHVWHQSODFHHWTXHOD ODPSHHVWpWHLQWH/HPRGHG DXWRQHWWR\DJHGDQVXQIRXU GRXEOHQHSHXWSDVrWUHXWLOLVpVLPXOWDQpPHQWGDQVOHVGHX[ IRXUV'HSOXVDXFXQDXWUHPRGHQHSHXWrWUHGpPDUUpGDQV l'autre cavité du four pendant l'autonettoyage de l'un des deux fours. IMPORTANT : &HUWDLQVRLVHDX[VRQWH[WUrPHPHQWVHQVLEOHV aux fumées dégagées pendant l'autonettoyage d'un four. Déplacez-les dans une autre pièce bien aérée. ENTRETIEN ET NETTOYAGE : 1HWWR\DJHGXIRXU±,QWpULHXU 49-2003957 Rev. 0 23 Nettoyage du four – Intérieur Probe (Sonde thermique) /DVRQGHWKHUPLTXHSHXWrWUHQHWWR\pHDYHFGHO HDX savonneuse ou un tampon à récurer imbibé de savon. /DLVVH]ODVRQGHWKHUPLTXHUHIURLGLUDYDQWGHODODYHU Frottez les taches rebelles avec un tampon à récurer imbibé de savon, rincez et séchez. 3RXUFRPPDQGHUGHVVRQGHVWKHUPLTXHVDGGLWLRQQHOOHV UHSRUWH]YRXVDX[VHFWLRQV©$FFHVVRLUHVªHW©6HUYLFH à la clientèle » à la fin de ce manuel. Ŷ 1 LPPHUJH]SDVODVRQGHWKHUPLTXHGDQVO HDX Ŷ Ne rangez pas la sonde thermique dans le four. Ŷ Ne laissez jamais la sonde thermique à l'intérieur du four pendant l'autonettoyage ou le nettoyage à la vapeur. GRILLES DE FOUR Si les grilles fournies avec votre four sont des grilles émaillées foncées, non brillantes, elles peuvent rester dans le four SHQGDQWOHF\FOHG¶DXWRQHWWR\DJHVDQVrWUHHQGRPPDJpHV 3RXUQHWWR\HUOHVJULOOHVPDQXHOOHPHQWXWLOLVH]GHO¶HDXFKDXGH VDYRQQHXVH$VVXUH]YRXVGHQHSDVODYHUOHVJOLVVLqUHVG¶XQH grille extensible. Si les grilles deviennent plus difficiles à retirer du four, mettez un peu d’huile végétale sur un chiffon doux ou un essuie-tout HWIURWWH]OHVVXSSRUWVGHJULOOHGXIRXU1(3$6DSSOLTXHU l’huile sur la glissière d’une grille extensible. REMARQUE : /¶XWLOLVDWLRQG¶DXWUHVKXLOHVGHFXLVVRQFRPPH O¶KXLOHG¶DUDFKLGH3DP ® ou d’autres aérosols lubrifiants peut entraîner une décoloration ou un résidu de couleur rouille sur OHVJULOOHVHWOHVSDURLVGHODFDYLWp3RXUQHWWR\HUFHUpVLGX utilisez une solution d’eau et de savon ou de vinaigre et d’eau. Rincez à l’eau claire et séchez avec un chiffon doux. 3pULRGLTXHPHQWLOSHXWrWUHQpFHVVDLUHGHOXEULILHUOHVJULOOHV GXIRXUjO¶DLGHGXOXEULILDQWIRXUQLDYHFYRWUHIRXU3RXU commander du lubrifiant supplémentaire, consultez la section accessoires de ce manuel. Utilisation du four : 1. Retirez la grille du four. Voir la section Grilles de four extensibles. 2. Dépliez totalement la grille sur la table ou le plan de travail. Nous vous recommandons de placer du papier journal sous la grille pour faciliter le nettoyage. 3. Si vous constatez la présence de résidus sur les barres coulissantes, éliminez-les à l’aide d’une serviette en papier. REMARQUE : 7RXWOXEULILDQWHVVX\pGRLWrWUHUpDSSOLTXp 4. Secouez le lubrifiant avant de l’ouvrir. En commençant par le mécanisme coulissant gauche de la grille, appliquez quatre (4) goutelettes de lubrifiant sur les deux (2) chenilles du mécanisme coulissant à proximité des porte-roulements. )DLWHVGHPrPHSRXUOHPpFDQLVPHFRXOLVVDQWGURLW 2XYUH]HWIHUPH]ODJULOOHSOXVLHXUVIRLVSRXUpWDOHUOH lubrifiant. 7. Replacez le bouchon du lubrifiant et secouez-le à nouveau. 5HWRXUQH]ODJULOOHHWUpSpWH]OHVpWDSHVHW 3RXU les supports de grille moulés uniquement dans la paroi de la cavité du four.) De plus, pour une performance de glissement optimale, assurez-vous d’ajouter quelques gouttes de lubrifiant sur OHVXSSRUW EUDFNHW HWOHUHVVRUWjSDOHWWH SDGGOHVSULQJ illustrés ci-dessous : 8. Fermez la grille, placez la grille avec le côté droit à la verticale et introduisez-la dans le four. Voir la section Grilles de cuisson extensibles. 9. Répétez les étapes ci-dessus pour chaque grille. Côté gauche Côté droit de la grille vers le haut Côté droit de la grille vers le haut Côté droit https://products.geappliances. com/appliance/gea-support- VHDUFKFRQWHQW"FRQWHQW,G Support Ressort à palette UTILISATION DU FOUR : 1HWWR\DJHGXIRXU±,QWpULHXU 24 49-2003957 Rev. 0 Lampe du four AVERTISSEMENT RISQUE DE CHOC ÉLECTRIQUE OU D'INCENDIE : $YDQWGHUHPSODFHUO DPSRXOHFRXSH] O DOLPHQWDWLRQGXIRXUDXQLYHDXGXWDEOHDXGHGLVWULEXWLRQ GLVMRQFWHXUVRXIXVLEOHV /HQRQUHVSHFWGH cette consigne peut entraîner un choc électrique ou des brûlures. ATTENTION RISQUE DE BRÛLURE : / DPSRXOHHWOHFRXYUHDPSRXOHHQYHUUHGRLYHQWrWUHUHWLUpVORUVTX LOVVRQWIURLGV 7RXFKHUOHYHUUHFKDXGjPDLQQXHRXDYHFXQFKLIIRQKXPLGHSHXWFDXVHUGHVEUOXUHV 1. Coupez le courant au niveau du tableau de distribution (fusible ou disjoncteur). 2. Retirez les grilles du four. 3. Faites glisser un tournevis à lame plate ou un couteau à beurre entre le boîtier métallique et le couvercle en verre de l'ampoule. REMARQUE : Sur certains modèles, il y a une attache métallique qui maintient visiblement le verre. / RXWLOGRLWrWUHLQVpUpHQWUHOHERvWLHUPpWDOOLTXHHWO DWWDFKH retenant le verre. 4. Soutenez le couvercle en verre de l'ampoule avec deux doigts pour éviter que le couvercle ne tombe au fond du four. 7RXUQH]GRXFHPHQWODODPHGXWRXUQHYLVRXGXFRXWHDXj beurre pour desserrer le couvercle en verre de l'ampoule. 9HLOOH]jQHSDVpEUpFKHUOHUHYrWHPHQWGXIRXU 6. Retirez le couvercle de l'ampoule. 7. Retirez l'ampoule en la saisissant fermement et en la faisant glisser vers l'extérieur jusqu'à ce que les deux broches se soient dégagées de la douille en céramique. 8. Ne touchez pas le verre de la nouvelle ampoule de remplacement avec vos doigts. Cela entraînera des GRPPDJHVjO DPSRXOHSRXYDQWO HPSrFKHUGHV DOOXPHU Saisissez l'ampoule de remplacement avec une serviette propre ou un mouchoir en papier avec les broches vers le EDV$OLJQH]OHVGHX[EURFKHVGDQVODGRXLOOHHQFpUDPLTXH en appuyant doucement jusqu'à ce que l'ampoule soit bien en place dans la douille. 9. Faites glisser le couvercle de protection dans le support et poussez jusqu'à ce que les fixations s'enclenchent dans le boîtier. 10. Rebranchez l'alimentation. ENTRETIEN ET NETTOYAGE : /DPSHGXIRXU 49-2003957 Rev. 0 25 Porte du four ENTRETIEN ET NETTOYAGE : 3RUWHGXIRXUIRXU Retrait de la porte du four inférieur REMARQUE : /HUHWUDLWGHODSRUWHQ¶HVWSDVUHTXLVSRXU l’installation de l’appareil, mais il s’agit d’une commodité supplémentaire. Pour retirer la porte : 2XYUH]ODSRUWHGXIRXUDXPD[LPXP 2. Retirez le support de charnière (s’il est présent) du cadre DYDQWHWPHWWH]OHGHF{Wp/HVXSSRUWGHFKDUQLqUHGRLW rWUHUHPLVHQSODFHSRXUDVVXUHUOHERQIRQFWLRQQHPHQWGH la porte lors de la réinstallation. 3RXVVH]OHVGHX[YHUURXVGHFKDUQLqUHYHUVOHEDV en direction du cadre de la porte, jusqu’à la position GpYHUURXLOOpH8QWRXUQHYLVjODPHSODWHSHXWrWUH nécessaire. NE SOULEVEZ PAS LA PORTE PAR LA POIGNÉE ! 3ODFH]OHVPDLQVGHVGHX[F{WpVGHODSRUWHHWIHUPH]OD porte du four jusqu’à la position de retrait (environ 1 à 2 po [2,5 cm à 5,1 cm] depuis la position fermée). 5. Soulevez la porte vers le haut et vers l’extérieur jusqu’à ce que les bras des charnières sortent des fentes. REMARQUE : /DSRUWHGXIRXUHVWWUqVORXUGH$VVXUH] vous d’avoir une prise solide avant de soulever la porte KRUVGHVFKDUQLqUHV8VH]GHSUXGHQFHXQHIRLVODSRUWH retirée. Ne déposez pas la porte sur sa poignée. Cela pourrait causer des bosses ou des rayures. Réinstallation de la porte du four inférieur REMARQUE : /DSRUWHGXIRXUHVWWUqVORXUGH'HO¶DLGHSHXW s’avérer nécessaire pour soulever la porte suffisamment haut pour la glisser dans les fentes de charnière. Ne soulevez pas la porte par la poignée. 1. Soulever la porte du four en l’agrippant de chaque côté. $YHFODSRUWHDXPrPHDQJOHTXHODSRVLWLRQGHUHWUDLW (environ 1 à 2 po [2,5 cm à 5,1 cm] depuis la position fermée), insérez l’encoche du bras de charnière dans le ERUGLQIpULHXUGHODIHQWHGHFKDUQLqUH/¶HQFRFKHGXEUDV GHFKDUQLqUHGRLWrWUHFRPSOqWHPHQWLQVpUpHGDQVOHEDVGH la fente. 2XYUH]FRPSOqWHPHQWODSRUWH6LODSRUWHQHV¶RXYUHSDV complètement, l’encoche n’est pas correctement insérée dans le bord inférieur de la fente. 3RXVVH]OHVYHUURXVGHFKDUQLqUHYHUVOHKDXWFRQWUH le cadre avant de la cavité du four, jusqu’à la position verrouillée. 5. Remettez en place le support de charnière (s’il est présent). /HVXSSRUWGHFKDUQLqUHGRLWrWUHUHPLVHQSODFHSRXU assurer le bon fonctionnement de la porte. 6. Fermez la porte du four. Charnière en position verrouillée Encoche de la charnière bien insérée dans le bas de la fente de charnière Bord inférieur de la fente Bras de charnière Encoche de la charnière Support de charnière Fente de charnière Bras de charnière 3RVLWLRQGpYHUURXLOOpH de la charnière /DFKDUQLqUHVRUW de la fente Support de charnière 26 49-2003957 Rev. 0 eFRQRPLVH]WHPSVHWDUJHQW&RQVXOWH]OHVWDEOHDX[GHVSDJHVVXLYDQWHVDYDQWGHIDLUHDSSHODXVHUYLFH9LVLRQQH]GHVYLGpRV G¶DXWRDVVLVWDQFHHWOD)$4j bodewell.com/faqs. Problème Causes possibles Solutions Mon nouveau four ne cuit pas les aliments comme mon ancien four. Y a-t-il un problème avec le réglage de la température? Votre nouveau four est doté d'un système de cuisson différent de celui de votre ancien four; par conséquent, il peut cuire les aliments différemment. 3RXUODSUHPLqUHXWLOLVDWLRQUHVSHFWH]OHVWHPSVHWOHV températures indiqués dans votre recette. Si vous pensez toujours que votre four chauffe trop ou ne chauffe pas assez, YRXVSRXYH]DMXVWHUODWHPSpUDWXUHYRXVPrPH&RQVXOWH] O RSWLRQ©&RRNLQJ FXLVVRQ ªGDQVODVHFWLRQ©5pJODJHVª pour régler la température du four. REMARQUE : Ce réglage affecte les températures de la cuisson traditionnelle, de la cuisson à convection et de la cuisson à convection multiple; il n'affectera pas le rôtissage à convection, la cuisson au gril traditionnelle, la cuisson au gril à convection ou le nettoyage. Les aliments ne cuisent pas correctement /HVFRPPDQGHVGXIRXUVRQWPDOUpJOpHV 5HSRUWH]YRXVjODVHFWLRQ©0RGHVGHFXLVVRQª /DJULOOHQ DSDVpWpSODFpHVXUODERQQHSRVLWLRQ dans le four ou n'est pas de niveau. 5HSRUWH]YRXVjODVHFWLRQ©0RGHVGHFXLVVRQªHWDX*XLGH de cuisson. 8VWHQVLOHGHFXLVVRQLQDSSURSULpRXGHGLPHQVLRQV inadéquates. 5HSRUWH]YRXVjODVHFWLRQ©8VWHQVLOHVGHFXLVVRQª /DWHPSpUDWXUHGXIRXUGRLWrWUHDMXVWpH 5HSRUWH]YRXVjO RSWLRQ©&RRNLQJ FXLVVRQ ªGDQV la section « Réglages ». Substitution d'ingrédients /DVXEVWLWXWLRQG LQJUpGLHQWVSHXWPRGLILHUOHUpVXOWDW Les aliments ne grillent pas correctement /HVFRPPDQGHVGXIRXUVRQWPDOUpJOpHV $VVXUH]YRXVGHVpOHFWLRQQHUOHPRGHGHFXLVVRQ au gril approprié. 3RVLWLRQGHJULOOHLQDSSURSULpH Consultez le Guide de cuisson pour des suggestions sur la position des grilles. /HVDOLPHQWVVRQWFXLWVGDQVXQXVWHQVLOHFKDXG $VVXUH]YRXVTXHO XVWHQVLOHGHFXLVVRQHVWIURLG 8QXVWHQVLOHGHFXLVVRQLQDSSURSULpSRXUOHJULO est utilisé. 8WLOLVH]XQXVWHQVLOHGHFXLVVRQFRQoXSRXUOHJULO /HSDSLHUG DOXPLQLXPXWLOLVpGDQVODOqFKHIULWHRXVXUODJULOOH n'est pas installé selon les recommandations. Si vous utilisez du papier d'aluminium, pratiquez des ouvertures vis-à-vis des ouvertures de la lèchefrite. Dans certaines régions, la tension électrique SHXWrWUHEDVVH 3UpFKDXIIH]O pOpPHQWGHJULOSHQGDQWPLQXWHV Température du four trop chaude ou trop froide /DWHPSpUDWXUHGXIRXUGRLWrWUHDMXVWpH 5HSRUWH]YRXVjO RSWLRQ©&RRNLQJ FXLVVRQ ªGDQV la section « Réglages ». Le four ne fonctionne pas, ou semble ne pas fonctionner 8QIXVLEOHGHYRWUHGRPLFLOHSHXWrWUHJULOOp ou le disjoncteur s'est déclenché. Remplacez le fusible ou réenclenchez le disjoncteur. /HVFRPPDQGHVGXIRXUVRQWPDOUpJOpHV &RQVXOWH]OHVVHFWLRQV©8WLOLVDWLRQGHO¶DSSDUHLOªHW©5pJODJH d’un mode de cuisson ». /HIRXUHVWHQPRGHVDEEDW $VVXUH]YRXVTXHOHIRXUQ HVWSDVHQPRGHVDEEDW5HSRUWH] vous à l'option « Sabbath (sabbat) » dans la section « Réglages ». Bruits de crépitement ou de craquement Ces sons proviennent du métal qui chauffe et refroidit pendant les fonctions de cuisson et d'autonettoyage. Cela est normal. Pourquoi ma cuisinière émet- elle un cliquetis lorsque j'utilise le four? Votre four a été conçu pour maintenir avec précision sa température. Vous pourriez entendre les éléments chauffants de votre four « cliquer » plus souvent que dans les anciens modèles afin d’obtenir de meilleurs résultats pendant les cycles de cuisson et de nettoyage. Cela est normal. L'horloge et la minuterie ne fonctionnent pas 8QIXVLEOHGHYRWUHGRPLFLOHSHXWrWUHJULOOp ou le disjoncteur s'est déclenché. Remplacez le fusible ou réenclenchez le disjoncteur. La lampe du four ne fonctionne pas / DPSRXOHHVWPDOVHUUpHRXHOOHHVWJULOOpH Resserrez ou remplacez l'ampoule. L'autonettoyage ne fonctionne pas /DWHPSpUDWXUHGXIRXUHVWWURSpOHYpHSRXUSURJUDPPHU l'autonettoyage. /DLVVH]OHIRXUUHIURLGLUHWUHSURJUDPPH]OH /HVFRPPDQGHVGXIRXUVRQWPDOUpJOpHV Reportez-vous à la section sur le nettoyage du four. Fumée excessive pendant l'autonettoyage Saleté ou graisse excessive. $SSX\H]VXU Cancel SRXUDUUrWHUOHF\FOH2XYUH]OHVIHQrWUHV SRXUpYDFXHUODIXPpHGHODSLqFH$WWHQGH]TXHODSRUWHVH déverrouille. Nettoyez l'excès de saleté et reprogrammez l'autonettoyage. Conseils de dépannage... $YDQWGHFRQWDFWHUOHVHUYLFHGHGpSDQQDJH ENTRETIEN ET NETTOYAGE 49-2003957 Rev. 0 27 ENTRETIEN ET NETTOYAGE Problème Causes possibles Solutions Fumée excessive en mode de cuisson au gril /HVDOLPHQWVVRQWWURSSUqVGHO pOpPHQW $EDLVVH]ODJULOOHGDQVOHIRXU La porte du four ne s'ouvre pas après l'autonettoyage Four trop chaud. /DLVVH]ODWHPSpUDWXUHGXIRXUUHGHVFHQGUHHQGHVVRXV de la température de verrouillage. Le four n'est pas propre après l'autonettoyage /HVFRPPDQGHVGXIRXUVRQWPDOUpJOpHV Reportez-vous à la section sur le nettoyage du four. /HIRXUpWDLWWUqVVDOH Nettoyez les éclaboussures importantes avant de lancer O DXWRQHWWR\DJH/HVIRXUVWUqVVDOHVSHXYHQWQpFHVVLWHU un second autonettoyage ou un autonettoyage plus long. « F– » suivi d'un chiffre ou d'une lettre sont affichés sur l'écran ACL ,OV DJLWG XQFRGHG HUUHXUGHIRQFWLRQ $SSX\H]VXU Dismiss HIIDFHU VXUO pFUDQ$&//DLVVH] le four refroidir pendant une heure. Rallumez le four. Si le code de fonction réapparaît. Coupez l'alimentation du four pendant au moins 30 secondes, puis rétablissez-la. Si le code d'erreur de fonction réapparaît, contactez un service de réparation. L'afficheur à cristaux liquide (ACL) ne fonctionne pas correctement 8QIXVLEOHGHYRWUHGRPLFLOHSHXWrWUHJULOOpRXOHGLVMRQFWHXU s'est déclenché. Remplacez le fusible ou réenclenchez le disjoncteur. /HVFRPPDQGHVGXIRXUVRQWPDOUpJOpHV &RQVXOWH]ODVHFWLRQ©0RGHVGHFXLVVRQªRX©5pJODJHVª SRXUDVVXUHUODERQQHXWLOLVDWLRQ$VVXUH]YRXVTXHOHORJLFLHOGH l'appareil a été mis à jour à la plus récente version. / pFUDQ$&/HVWYHUURXLOOp Déverrouillez l'écran en appuyant sur Unlock (déverrouiller). Si cela ne corrige pas le problème, coupez et rétablissez l'alimentation au disjoncteur et assurez-vous que le logiciel de l'appareil a été mis à jour à la plus récente version. /¶pFUDQWDFWLOHQHUpSRQGSDVFRUUHFWHPHQW 3ODFH]WRXWHYRWUHPDLQVXUO¶pFUDQWDFWLOHSHQGDQWVHFRQGHV puis retirez-la pour réinitialiser la sensibilité de l’écran tactile. / pFUDQ$&/HVWGpIHFWXHX[ Coupez et rétablissez l'alimentation au disjoncteur et assurez- vous que le logiciel de l'appareil a été mis à jour à la plus récente version. Si le problème persiste, appelez le service à la clientèle pour faire évaluer le problème. Panne de courant, réinitialisation de l'horloge Coupure de courant ou surtension. Remettez l'horloge à l'heure. Si le four était en cours d'utilisation, vous devez le reprogrammer en appuyant sur la touche Cancel (annuler), en remettant l'horloge à l'heure et en reprogrammant la fonction de cuisson choisie. Odeur de « brûlé » ou d'huile provenant de l'évent Cela est normal pour un nouveau four et disparaît avec le temps. 3RXUDFFpOpUHUFHSURFHVVXVSURJUDPPH]XQDXWRQHWWR\DJHG DX moins 3 heures. Reportez-vous à la section sur le nettoyage du four. Forte odeur ,OHVWQRUPDOTX XQHRGHXUVHGpJDJHGHO LVRODQWGHO LQWpULHXU du four pendant les premières utilisations du four. Ceci est temporaire et cessera avec le temps ou après un cycle d'autonettoyage. Bruit de ventilateur 8QYHQWLODWHXUGHUHIURLGLVVHPHQWSHXWDXWRPDWLTXHPHQWVH mettre en marche. &HODHVWQRUPDO/HYHQWLODWHXUGHUHIURLGLVVHPHQWVHPHWWUDHQ marche pour refroidir les composants internes. ,OSHXWIRQFWLRQQHUMXVTX jKDSUqVO DUUrWGXIRXU La vitre de ma porte de four semble teintée ou présente un arc-en-ciel. Est-elle défectueuse? 1RQ/HYHUUHLQWpULHXUGHODSRUWHGXIRXUHVWUHYrWXG XQH barrière thermique qui réfléchit la chaleur dans le four pour prévenir la perte de chaleur et pour garder l'extérieur de la porte froide pendant la cuisson. Cela est normal. Dans certaines conditions d'éclairage et selon l'angle de vue, il est possible de percevoir une teinte ou les couleurs de l'arc-en-ciel. Il arrive que le four prenne plus de temps à préchauffer pour atteindre la même température 8VWHQVLOHGHFXLVVRQRXDOLPHQWGDQVOHIRXU / XVWHQVLOHGHFXLVVRQRXOHVDOLPHQWVSODFpVGDQVOHIRXU prolongent le préchauffage. Retirez les aliments pour diminuer le temps de préchauffage. Nombre de grilles dans le four. / DMRXWGHJULOOHVGDQVOHIRXUSURORQJHOHWHPSVGHSUpFKDXIIDJH Retirez quelques grilles. 0RGHVGHFXLVVRQGLYHUV /HVGLIIpUHQWVPRGHVGHFXLVVRQXWLOLVHQWGLIIpUHQWHVPpWKRGHVGH préchauffage pour chauffer le four. Certains modes de cuisson prendront plus de temps que d'autres (ex. : cuisson à convection multiple). Le four ne fonctionne pas à distance 3UREOqPHVGHURXWHXUSDVGHVLJQDOVDQVILOHWF 3RXUREWHQLUGHO DLGHVXUODFRQQHFWLYLWpUpVHDXVDQVILO du four, veuillez appeler le 1-800-220-6899. /HIRXUQ HVWSDVFRQQHFWp Conseils de dépannage... $YDQWGHFRQWDFWHUOHVHUYLFHGHGpSDQQDJH 28 49-2003957 Rev. 0 GARANTIE LIMITÉE $JUDIH]YRWUHIDFWXUHLFL8QHSUHXYHGHODGDWHG DFKDWG RULJLQH est requise pour obtenir des services sous garantie. 7RXWHVOHVUpSDUDWLRQVVRXVJDUDQWLHVRQWHIIHFWXpHVSDUQRV&HQWUHVGHUpSDUDWLRQRXSDUQRVUpSDUDWHXUVDJUppV&XVWRPHU&DUH ® 3RXU faire la demande d'une réparation en ligne, visitez Bodewell.com/schedule-repair-service , ou appelez 833-4BODEWELL (833-426-3393). $X&DQDGDYHXLOOH]YLVLWHU electromenagersge.ca/soutien-apres-vente . Veuillez avoir les numéros de série et de modèle de votre appareil à portée de main lorsque vous appelez pour obtenir un service. /¶HQWUHWLHQGHYRWUHDSSDUHLOSRXUUDLWQpFHVVLWHUO¶XWLOLVDWLRQG¶XQDFFqVDX[GRQQpHVHPEDUTXpHVSRXUOHGLDJQRVWLF&HODSHUPHWDX WHFKQLFLHQGHO¶DWHOLHUGHUpSDUDWLRQ*($SSOLDQFHVGHGLDJQRVWLTXHUUDSLGHPHQWWRXWHGpIDLOODQFHGHYRWUHpOHFWURPpQDJHUHWj*( $SSOLDQFHVG¶DPpOLRUHUODTXDOLWpGHVHVSURGXLWV6LYRXVQHVRXKDLWH]SDVWUDQVPHWWUHOHVGRQQpHVGHYRWUHDSSDUHLOj*($SSOLDQFHV veuillez aviser votre technicien de s’en abstenir au moment de la visite de service. Ce que GE Appliances ne couvre pas : Ŷ /¶HQYRLG¶XQWHFKQLFLHQFKH]YRXVSRXUYRXVPRQWUHUFRPPHQW utiliser le produit. Ŷ 8QHLQVWDOODWLRQXQHOLYUDLVRQRXXQHQWUHWLHQLQDGpTXDWV Ŷ 8QHSDQQHGXSURGXLWVXLWHjXQHXWLOLVDWLRQDEXVLYHRX inadéquate, une modification, un usage autre que celui auquel il a été destiné ou un usage commercial. Ŷ /HUHPSODFHPHQWGHVIXVLEOHVGHYRWUHUpVLGHQFHRXOH réenclenchement des disjoncteurs. Ŷ /HVGRPPDJHVDXSURGXLWFDXVpVSDUXQDFFLGHQWXQLQFHQGLH une inondation ou une catastrophe naturelle. Ŷ 'RPPDJHVDFFLGHQWHOVRXFRQVpFXWLIVFDXVpVSDUG pYHQWXHOV défauts de cet appareil. Ŷ /HVGRPPDJHVVXUYHQXVDSUqVODOLYUDLVRQ Ŷ /HVHUYLFHV¶LOHVWLPSRVVLEOHG¶DYRLUDFFqVDXSURGXLW Ŷ /HVHUYLFHSRXUUpSDUHURXUHPSODFHUOHVDPSRXOHVj O¶H[FHSWLRQGHVODPSHV'(/ Ŷ /HVGRPPDJHVDXILQLWHOVTXHODURXLOOHGHVXUIDFHOH ternissement ou les petites imperfections qui ne sont pas rapportés dans les 48 heures suivant la livraison. Garantie limitée du four mural EXCLUSION DES GARANTIES IMPLICITES 9RWUHVHXOHWXQLTXHUHFRXUVHVWODUpSDUDWLRQGXSURGXLWVHORQOHVGLVSRVLWLRQVGHODSUpVHQWHJDUDQWLHOLPLWpH7RXWHVJDUDQWLHV implicites, y compris les garanties implicites de qualité marchande et d’adéquation à un usage spécifique, sont limitées à un an ou à la plus courte période permise par la loi. Durant une période de GE Appliances remplacera Un an depuis la date d’achat d’origine Toute pièce défectueuse en raison d'un vice de matière ou de fabrication. Durant cette garantie limitée d’un an *($SSOLDQFHV assumera tous les frais de main-d'œuvre et de service à domicile afférents au remplacement de la pièce défectueuse. Deux ans depuis la date d’achat d’origine de four de PDUTXH0RQRJUDP Toute pièce défectueuse en raison d'un vice de matière ou de fabrication. Durant cette garantie limitée de deux ans *($SSOLDQFHV assumera tous les frais de main-d'œuvre et de service à domicile afférents au remplacement de la pièce défectueuse. POUR LES CLIENTS DES ÉTATS-UNIS : Cette garantie limitée est offerte à l’acheteur initial et à tout propriétaire VXEVpTXHQWG¶XQSURGXLWDFKHWpDX[eWDWV8QLVjGHVILQV d’usage domestique. Si le produit est situé dans une localité où un réparateur autorisé GE n’est pas disponible, vous pourriez encourir des frais de déplacement ou devoir acheminer le produit à un réparateur autorisé GE pour faire réparer l’appareil. (Q$ODVNDFHWWHJDUDQWLHOLPLWpHH[FOXWOHVIUDLVG¶H[SpGLWLRQHW les visites de service à votre domicile. &HUWDLQVeWDWVRXSURYLQFHVQHSHUPHWWHQWSDVO¶H[FOXVLRQ ou la restriction des dommages accessoires ou indirects. Certains droits particuliers vous sont dévolus en vertu de la présente garantie et peuvent s’accompagner d’autres droits TXLYDULHQWVHORQYRWUHOLHXGHUpVLGHQFH3RXUFRQQDvWUHOD nature exacte de vos droits, consultez l’organisme de protection du consommateur de votre région, ou encore le bureau du SURFXUHXUJpQpUDOGHO¶eWDW Garant : GE Appliances, a Haier company, /RXLVYLOOH.< AU CANADA (INCLUANT LA PROVINCE DE QUÉBEC) : Cette garantie limitée s’étend à l’acheteur initial et à tous les propriétaires ultérieurs pour les produits achetés au Canada, y compris au Québec, et qui sont destinés à un usage GRPHVWLTXHDX&DQDGD\FRPSULVDX4XpEHF7RXWHIRLVVLOH produit se trouve dans une région où un réparateur agréé GE $SSOLDQFHVQ¶HVWSDVGLVSRQLEOHYRXVSRXUULH]rWUHWHQXGH payer des frais de déplacement ou de vous rendre dans un FHQWUHGHVHUYLFHDJUpp*($SSOLDQFHV&HUWDLQVWHUULWRLUHV comme le Québec, interdisent l’exclusion ou la restriction des dommages collatéraux ou indirects. Cette garantie limitée vous confère des droits légaux spécifiques ; vous pouvez également bénéficier d’autres droits qui varient d’une province à l’autre, \FRPSULVDX4XpEHF3RXUHQVDYRLUSOXVVXUYRVGURLWV légaux, adressez-vous à votre bureau régional ou provincial de protection des consommateurs. À L’INTENTION DES CONSOMMATEURS QUÉBÉCOIS UNIQUEMENT - AVIS SUR LA GARANTIE DE DISPONIBILITÉ DES PIÈCES DE RECHANGE, DES SERVICES DE RÉPARATION ET DES RENSEIGNEMENTS NÉCESSAIRES À LA RÉPARATION OU À L’ENTRETIEN (ART. 39 DE LA LOI SUR LA PROTECTION DU CONSOMMATEUR): 9HXLOOH]QRWHUTXH0&&RPPHUFLDO,QF ©0&&RPPHUFLDOª QHJDUDQWLWSDVDXVHQVGHO¶DUWLFOH GHOD/RLVXUODSURWHFWLRQGXFRQVRPPDWHXU5/54F3 et des articles 79.18 à 79.20 du Règlement d’application de OD/RLVXUODSURWHFWLRQGXFRQVRPPDWHXU5/54F3 r. 3, la disponibilité des pièces de rechange, des services de réparation ou des renseignements nécessaires à l’entretien ou à la réparation des biens fabriqués, importés, annoncés ou YHQGXVSDU0&&RPPHUFLDO 9HXLOOH]QRWHUTXH0&&RPPHUFLDO,QFFRQWLQXHG¶RIIULUOD garantie limitée du fabricant, telle qu’énoncée dans le manuel du propriétaire ou le guide rapide. Cette garantie limitée diffère de la garantie légale de disponibilité énoncée à l’article 39 de OD/RLVXUODSURWHFWLRQGXFRQVRPPDWHXU Garant : MC Commercial Inc., Burlington, ON, L7L 6B2 PROLONGATION DE GARANTIE : $FKHWH]XQFRQWUDW G¶HQWUHWLHQ*($SSOLDQFHVHWLQIRUPH]YRXVGHVUDEDLVVSpFLDX[ en vigueur pendant toute la durée de votre garantie. Vous pouvez vous le procurer en tout temps sur electromenagersge.ca/achat-dune-garantie-prolongee ou en composant le 866-884-5646 durant les heures normales GHEXUHDX/HVHUYLFHDSUqVYHQWH*($SSOLDQFHVVHUDWRXMRXUV disponible après l’expiration de votre garantie. 49-2003957 Rev. 0 29 ACCESSOIRES Vous manquez de quelque chose? Électroménagers GE propose une panoplie d'accessoires qui permettent d'améliorer votre expérience de cuisson et de nettoyage! Reportez-vous à la page du service à la clientèle pour obtenir les numéros de téléphone et des informations sur le site Web. /HVSURGXLWVVXLYDQWVHWG DXWUHVVRQWRIIHUWV Accessoires Accessoires 3HWLWHOqFKHIULWH ô[ó[òSR[[FP *UDQGH OqFKHIULWH ô[ó[òSR[[FP 7UqVJUDQGH OqFKHIULWH [ó[óSR[[FP Pièces Grilles de four eOpPHQWVGHIRXU $PSRXOHV Sonde thermique Fournitures de nettoyage /LQJHWWHVSRXUDFLHULQR[\GDEOH Nettoyant pour appareil en acier inoxydable /XEULILDQWjEDVH /DJUDQGHOqFKHIULWHQHFRQYLHQWSDVDX[FXLVLQLqUHVGHSRSR FPFP /DWUqVJUDQGHOqFKHIULWHQHFRQYLHQWSDVDX[IRXUVHQFDVWUpVGHSR FP aux cuisinières encastrables de 27 po (68,6 cm) ou aux cuisinières de 20 po (50,8 cm) ou 24 po (61 cm). 30 49-2003957 Rev. 0 Service à la clientèle SERVICE À LA CLIENTÈLE Aux États-Unis – Visitez-nous à GEAppliances.com ou composez le 800.626.2005 Au Canada – Visitez-nous à GEAppliances.ca ou composez le 877.994.5366 7URXYH]GHVUHQVHLJQHPHQWVSRXUOHVSURSULpWDLUHVVXUQRWUHVLWH:HE : • Information • Enregistrez l’appareil • Planifiez un service • Achetez des pièces, accessoires ou garanties prolongées • Connectez votre appareil – 800.220.6899 6LYRXVQ¶rWHVSDVVDWLVIDLWGXVHUYLFHFRQWDFWH]QRXVVXUQRWUHVLWH:HEHQLQFOXDQWWRXVOHVGpWDLOVDLQVLTXHYRWUH numéro de téléphone, ou écrivez à : Aux États-Unis - *HQHUDO0DQDJHU&XVWRPHU5HODWLRQV_*($SSOLDQFHV_$SSOLDQFH3DUN_/RXLVYLOOH.< Au Canada - Director, Customer Relations _0&&RPPHUFLDO,QF_%XUORDN'U6XLWH_%XUOLQJWRQ21//% GEAppliances.com GEAppliances.ca MANUAL DEL PROPIETARIO Escriba los números de modelo y de serie aquí: Nº de Modelo ____________ Nº de Serie ______________ Los podrá encontrar en una etiqueta en el borde lateral o en el frente del horno (inferior) detrás de la puerta del horno. HORNO DE PARED Eléctrico Empotrado 49-2003957 Rev. 0 04-26 GE es una marca registrada de General Electric Company. Fabricado bajo licencia de marca. Horno de pared PTS9200 INFORMACIÓN DE SEGURIDAD . . . 3 USO DEL ELECTRODOMÉSTICO Conectividad Wi-Fi . . . . . . . . . . . . . . . . . . . . . . . . 6 Pantalla de Inicio . . . . . . . . . . . . . . . . . . . . . . . . . . 7 Settings (Configuraciones) . . . . . . . . . . . . . . . . . . 9 Modo Sabático . . . . . . . . . . . . . . . . . . . . . . . . . . . .10 Estantes del Horno . . . . . . . . . . . . . . . . . . . . . . . . . 11 Papel de Aluminio y Cobertores del Horno . . . . 12 Guía para Utensilios de Cocina . . . . . . . . . . . . . . 12 Modos de Cocción . . . . . . . . . . . . . . . . . . . . . . . . . 13 Probe (Sonda). . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17 Guías de Cocción . . . . . . . . . . . . . . . . . . . . . . . . . .19 Modo de Cocción para Freír con Aire . . . . . . . 20 CUIDADO Y LIMPIEZA Cuidado y limpieza - Exterior. . . . . . . . . . . . . . . . 21 Cuidado y limpieza - Interior . . . . . . . . . . . . . . . 22 Probe (Sonda). . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 Bandejas del Horno . . . . . . . . . . . . . . . . . . . . . . . 23 Luz del Horno . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24 Puerta del Horno . . . . . . . . . . . . . . . . . . . . . . . . . 25 CONSEJOS PARA LA SOLUCIÓN DE PROBLEMAS . . . 26 GARANTÍA LIMITADA . . . . . . . . . . . . 28 ACCESORIOS . . . . . . . . . . . . . . . . . . . . . . 29 SOPORTE PARA EL CONSUMIDOR . . . . . . . . . . . . . . . . . 30 ESPAÑOL 2 49-2003957 Rev. 0 GRACIAS POR HACER QUE GE APPLIANCES SEA PARTE DE SU HOGAR. Ya sea que haya crecido usando GE Appliances, o que ésta es su primera vez, nos complace tenerlo en la familia. Sentimos orgullo por el nivel de arte, innovación y diseño de cada uno de los electrodomésticos de GE Appliances, y creemos que usted también. Entre otras cosas, el registro de su electrodoméstico asegura que podamos entregarle información importante del producto y detalles de la garantía cuando los necesite. Registre su electrodoméstico GE ahora a través de Internet. Sitios Web y números telefónicos útiles están disponibles en la sección de Soporte para el Consumidor de este Manual del Propietario. También puede enviar una carta en la tarjeta de inscripción preimpresa que se incluye con el material embalado. 49-2003957 Rev. 0 3 LEA Y GUARDE ESTAS INSTRUCCIONES INFORMACIÓN IMPORTANTE DE SEGURIDAD LEA TODAS LAS INSTRUCCIONES ANTES DE USAR ESTE ELECTRODOMÉSTICO INFORMACIÓN DE SEGURIDAD ADVERTENCIA INSTRUCCIONES GENERALES DE SEGURIDAD Ŷ 8VHHVWHDSDUDWRVyORFRQHOREMHWLYRSDUDHOTXHIXH creado, como se describe en este Manual del Propietario. Ŷ 6ROLFLWHTXHXQLQVWDODGRUFDOLILFDGRLQVWDOHVXHVWXID\ que esté adecuadamente conectada a tierra, de acuerdo con las instrucciones de instalación provistas. Ŷ &XDOTXLHUDMXVWHUHSDUDFLyQRVHUYLFLRWpFQLFRQR recomendado específicamente en este manual deberá ser realizado SOLO por un instalador o técnico del servicio con calificación en estufas. Ŷ $QWHVGHUHDOL]DUFXDOTXLHUFODVHGHUHSDUDFLyQ desenchufe la cocina o desconecte el suministro eléctrico desde el panel de distribución doméstico quitando el fusible o desconectando el interruptor de circuitos. Ŷ $VHJ~UHVHGHTXHWRGRVORVPDWHULDOHVGHHPEDODMHVHDQ retirados de la estufa antes de su uso, a fin de evitar que los mismos se incendien. Ŷ (YLWHUD\RQHVRLPSDFWRVVREUHODVSXHUWDVGHYLGULR placas de cocción o paneles de control. Hacer esto podrá producir la rotura de vidrios. Ŷ 1RFRFLQHVREUHXQSURGXFWRFRQXQYLGULRURWR6H podrán producir descargas, incendios o cortes. Ŷ 1RGHMHDORVQLxRVVRORVRVLQDWHQFLyQHQXQiUHD GRQGHXQDSDUDWRHVWpHQXVR1XQFDGHEHSHUPLWLUVH que se suban, sienten o paren en cualquier parte de este aparato. Ŷ PRECAUCIÓN 1RJXDUGHtWHPVGHLQWHUpV para los niños en los gabinetes que están sobre o en la parte superior de una estufa; si los niños trepan sobre la estufa para alcanzar estos artículos podrán sufrir lesiones graves. Ŷ 1XQFDXVHHOHOHFWURGRPpVWLFRSDUDFDOHQWDUR calefaccionar la habitación. Ŷ 1RSHUPLWDTXHQDGLHVHWUHSHVHSDUHRFXHOJXHGH la puerta del horno, del cajón o la placa de cocción. Se podrá dañar la estufa o provocar su caída, ocasionando lesiones graves o la muerte. Ŷ 6yORXVHDJDUUDGHUDVVHFDVODVDJDUUDGHUDVK~PHGDV o mojadas colocadas en superficies calientes pueden SURYRFDUTXHPDGXUDVGHYDSRU1RSHUPLWDTXHODV agarraderas tengan contacto con las unidades de la superficie ni con los elementos para calentar del horno. 1RXWLOLFHWRDOODVXRWUDVWHODVJUXHVDVHQOXJDUGHXQD agarradera. Ŷ 1RWRTXHORVTXHPDGRUHVSODQFKDV HQDOJXQRV PRGHORV SDUULOODV HQDOJXQRVPRGHORV ODVXSHUILFLH de cocción o los elementos calefactores del horno, ni la superficie interior del horno. Estas superficies podrán permanecer lo suficientemente caliente como para quemar durante un período de tiempo prolongado luego de la cocción, incluso aunque ya no parezcan estar encendidas o calientes. Ŷ 'XUDQWH\GHVSXpVGHOXVRQRWRTXHQLSHUPLWDTXHWHODV u otros materiales inflamables toquen cualquier área interior del horno; espere a que haya pasado un tiempo suficiente hasta que se enfríen. Otras superficies del electrodoméstico se podrán calentar lo suficiente como para ocasionar lesiones. Las superficies potencialmente calientes incluyen quemadores o elementos calefactores, SDUULOODV HQDOJXQRVPRGHORV VXSHUILFLHGHFRFFLyQ aberturas de la ventilación del horno, superficies cercanas a las aberturas, grietas alrededor de la puerta del horno, partes con marcos metálicos por encima de la puerta, cualquier protección trasera, o repisas ubicadas encima de una superficie de cocción. Ŷ 1RFDOLHQWHUHFLSLHQWHVFHUUDGRVGHDOLPHQWRV3RGUtD haber una acumulación de presión en el recipiente y éste podría explotar, provocando lesiones. Ŷ &RFLQHODFRPLGDFRPSOHWDPHQWHSDUDHYLWDUTXHVH SURGX]FDQHQIHUPHGDGHVDSDUWLUGHODFRPLGD86'$ \)'$EULQGDQODVUHFRPHQGDFLRQHVGHWHPSHUDWXUD PtQLPDSDUDXQDFRPLGDVHJXUD8WLOLFHXQWHUPyPHWUR para tomar la temperatura de la comida y haga controles en diferentes ubicaciones. Ŷ 0DQWHQJDOLPSLDODFDPSDQDGHOYHQWLODGRU\ORVILOWURV de grasa, con el fin de conservar una buena ventilación y de evitar incendios con grasa. En caso de incendio, apague el ventilador. Si el extractor se encuentra en funcionamiento, podrá esparcir las llamas. ADVERTENCIA /HDWRGDVODVLQVWUXFFLRQHVGHVHJXULGDGDQWHVGHXWLOL]DUHVWHSURGXFWR1RVHJXLUHVWDV instrucciones puede generar un incendio, una descarga eléctrica, lesiones corporales o la muerte. ADVERTENCIA MANTENGA LOS MATERIALES INFLAMABLES ALEJADOS DE LA ESTUFA Si esto no se cumple, se podrán sufrir lesiones personales graves o incendios. Ŷ 1RDOPDFHQHRXWLOLFHPDWHULDOHVLQIODPDEOHVGHQWURGH un horno o cerca de la estufa, tales como papel, plástico, agarraderas, telas, recubrimientos de pared, cortinas y gasolina u otros vapores y líquidos inflamables. Ŷ 1XQFDXVHYHVWLPHQWDVKROJDGDVRDPSOLDVPLHQWUDVXWLOLFH el aparato. Estas vestimentas pueden prenderse fuego si entran en contacto con superficies calientes, provocando quemaduras graves. Ŷ 1RSHUPLWDTXHODJUDVDGHODFRFFLyQXRWURVPDWHULDOHV inflamables se acumulen dentro de la estufa o en su cercanía. La grasa dentro del horno o sobre la estufa puede encenderse. Ŷ 1RJXDUGHPDWHULDOHVLQIODPDEOHVQLtWHPVVHQVLEOHVDOD temperatura dentro del electrodoméstico. Ŷ /LPSLHODVFDPSDQDVGHYHQWLODFLyQGHIRUPDIUHFXHQWH1R se debe permitir la acumulación de grasa en la campana o el filtro. Ŷ (QDOJXQRVPRGHORV )XQFLRQDPLHQWR5HPRWR(VWH electrodoméstico permite su configuración para permitir un funcionamiento remoto en cualquier momento. 4 49-2003957 Rev. 0 LEA Y GUARDE ESTAS INSTRUCCIONES INFORMACIÓN DE SEGURIDAD INFORMACIÓN IMPORTANTE DE SEGURIDAD LEA TODAS LAS INSTRUCCIONES ANTES DE USAR ESTE ELECTRODOMÉSTICO ADVERTENCIA EN CASO DE INCENDIO, SIGA LOS SIGUIENTES PASOS PARA EVITAR LA PROPAGACIÓN DEL FUEGO Ŷ 1RXWLOLFHDJXDHQLQFHQGLRVGHJUDVD1XQFDOHYDQWH una sartén en llamas. Apague los controles. Apague una sartén en llamas sobre una unidad de superficie cubriendo la sartén por completo con una tapa que ajuste bien, una plancha para galletas o una bandeja SODQD8WLOLFHXQTXtPLFRVHFRPXOWLXVRRXQH[WLQWRUGH incendios de espuma. Ŷ 6LKD\XQLQFHQGLRHQHOKRUQRGXUDQWHHOKRUQHDGR apáguelo cerrando la puerta del horno y apagando el control o usando un químico seco multiuso o un extintor de incendios de espuma. Ŷ 6LKD\XQLQFHQGLRHQHOKRUQRGXUDQWHODDXWROLPSLH]D apague el horno y espere a que el incendio se consuma. 1RDEUDODSXHUWDGHOKRUQRDODIXHU]D El ingreso de aire IUHVFRDWHPSHUDWXUDVGHDXWROLPSLH]DSXHGHSURYRFDU XQDH[SORVLyQGHOODPDVGHVGHHOKRUQR1RVHJXLUHVWD instrucción puede provocar quemaduras graves. ADVERTENCIA INSTRUCCIONES DE SEGURIDAD DEL HORNO Ŷ 0DQWpQJDVHDOHMDGRGHOKRUQRDODEULUODSXHUWDGHO mismo. El aire caliente o el vapor que sale puede causar quemaduras en las manos, rostro y/u ojos. Ŷ 1RXVHHOKRUQRVLXQHOHPHQWRGHFDOHQWDPLHQWRJHQHUD un punto brillante durante el uso o aparecen otros signos GHGDxRV8QSXQWREULOODQWHLQGLFDTXHHOHOHPHQWRSDUD calentar puede fallar y generar una posible quemadura, incendio o descarga eléctrica. Apague el horno de inmediato y solicite a un técnico calificado del servicio que reemplace el elemento para calentar. Ŷ 0DQWHQJDGHVREVWUXLGDODYHQWLODFLyQGHOKRUQR Ŷ 1XQFDFRORTXHORVXWHQVLOLRVGHFRFLQDSLHGUDVSDUD pizza u horneado o cualquier otro tipo de aluminio o cobertor en la base del horno. Estos ítems pueden atrapar el calor o derretirse, ocasionando daños sobre el producto y el riesgo de descargas, humo o incendios. Ŷ &RORTXHORVHVWDQWHVGHOKRUQRHQODXELFDFLyQGHVHDGD mientras éste se encuentra frío. Si es necesario mover el estante mientras el horno está caliente, tenga cuidado de evitar tocar superficies calientes y evite que el mango de la olla tenga contacto con el elemento calentador en el horno. Ŷ 1RGHMHSURGXFWRVWDOHVFRPRSDSHOXWHQVLOLRVGHFRFLQD ni comida en el horno cuando éste no se encuentre en uso. Los artículos guardados en el horno se pueden incendiar. Ŷ 1RGHMHDUWtFXORVVREUHODVXSHUILFLHGHFRFFLyQ cerca de la ventilación del horno. Los ítems se podrán sobrecalentar, y existe el riesgo de incendio o quemaduras. Ŷ 1XQFDDVHFRQODSXHUWDDELHUWD Ŷ 0DQWHQJDHOKRUQROLEUHGHDFXPXODFLyQGHJUDVD/D grasa del horno se puede incendiar. Ŷ $OXVDUODVEROVDVSDUDFRFLQDURGRUDUHQHOKRUQRVLJD las instrucciones del fabricante. Ŷ PELIGRO DE DESCARGA O QUEMADURAS: Antes de reemplazar la bombilla de luz del horno, desconecte la conexión eléctrica del horno desde el fusible principal o desde el panel del disyuntor. Si esto no se cumple, se podrá producir una descarga eléctrica o un incendio. Ŷ PRECAUCIÓN RIESGO DE INCENDIO: La tapa de vidrio y la bombilla de luz se deberán retirar cuando estén frías. Tocar el vidrio caliente sin protección en las manos o con una tela húmeda podrá ocasionar quemaduras. Ŷ 1RXVHQLQJ~QWLSRGHDOXPLQLRRFREHUWRUSDUDFXEULU el fondo del horno o cualquier parte del horno, excepto como se describe en este manual. Los cobertores de horno pueden atrapar el calor o derretirse, ocasionando daños sobre el producto y el riesgo de descargas, humo o incendios. ADVERTENCIA INSTRUCCIONES DE SEGURIDAD DEL HORNO CON LIMPIEZA AUTOMÁTICA (en algunos modelos) La función de limpieza automática usa el horno en temperaturas lo suficientemente altas como para consumir la suciedad de comida que haya dentro del horno. Para un funcionamiento seguro, siga estas instrucciones. Ŷ 1RWRTXHODVVXSHUILFLHVGHOKRUQRGXUDQWHHOFLFORGH limpieza automática. Mantenga a los niños alejados del horno durante la limpieza automática. Si no se siguen estas instrucciones, se podrán producir quemaduras. Ŷ $QWHVGHXWLOL]DUHOFLFORGHOLPSLH]DDXWRPiWLFDUHWLUH las ollas, estantes de metal brillante del horno y otros utensilios que haya en el horno. Sólo se pueden dejar dentro del horno los estantes para horno de color RVFXURFRQUHYHVWLPLHQWRGHSRUFHODQD1RKDFHUHVWR podrá ocasionar daños sobre estos ítems y el horno, y presentar una posible quemadura o riesgo de incendio. Ŷ $QWHVGHXWLOL]DUHOFLFORGHOLPSLH]DDXWRPiWLFDOLPSLH ODJUDVD\UHVWRVGHFRPLGDTXHKD\DHQHOKRUQR8QD cantidad excesiva de grasa se puede incendiar, lo cual puede producir daños con humo en su hogar. Ŷ 6LHOPRGRGHOLPSLH]DDXWRPiWLFDIXQFLRQDGHIRUPD incorrecta, apague el horno y desconecte el suministro de corriente. Solicite el servicio de un técnico calificado. 49-2003957 Rev. 0 5 LEA Y GUARDE ESTAS INSTRUCCIONES INFORMACIÓN DE SEGURIDAD INFORMACIÓN IMPORTANTE DE SEGURIDAD LEA TODAS LAS INSTRUCCIONES ANTES DE USAR ESTE ELECTRODOMÉSTICO ADVERTENCIA INSTRUCCIONES DE SEGURIDAD DEL HORNO CON LIMPIEZA AUTOMÁTICA (en algunos modelos) (Cont.) Ŷ 1RXVHOLPSLDGRUHVSDUDKRUQR1RVHGHEHUiXVDU limpiadores comerciales para horno ni revestimientos de protección para hornos de ningún tipo en o alrededor de cualquier parte del horno, a menos que cuente con certificación para uso en un horno con limpieza automática. Ŷ 1ROLPSLHODMXQWDGHODSXHUWD/DMXQWDGHODSXHUWDHV esencial para un buen sellado. Se debe tener cuidado de no frotar, dañar ni mover la junta. Ŷ IMPORTANTE: La salud de algunas aves es extremadamente sensible a los humos emitidos durante el ciclo de limpieza automática de cualquier estufa. Coloque las aves en otra habitación bien ventilada. FORMA ADECUADA DE DESCARTAR SU ELECTRODOMÉSTICO 'HVFDUWHRUHFLFOHVXHOHFWURGRPpVWLFRGHDFXHUGRFRQODV5HJXODFLRQHV)HGHUDOHV\/RFDOHV&RPXQtTXHVHFRQODV autoridades locales para descartar o reciclar su electrodoméstico de forma ambientalmente segura. Cómo Retirar la Película Protectora de Envío y la Cinta de Embalaje Con cuidado tome un extremo de la película protectora de envío con los dedos y lentamente retire la misma de la VXSHUILFLHGHOHOHFWURGRPpVWLFR1RXWLOLFHQLQJ~QSURGXFWR filoso para retirar la película. Retire toda la película antes de usar el electrodoméstico por primera vez. Para asegurar que no haya daños sobre el acabado del producto, la forma más segura de retirar el adhesivo de la cinta de embalaje en electrodomésticos nuevos es aplicando un detergente líquido hogareño para lavar platos. Aplique con una tela suave y deje que se seque. NOTA: El adhesivo deberá ser eliminado de todas las partes. 1RVHSXHGHUHWLUDUVLVHKRUQHDFRQpVWHGHQWUR Tenga en cuenta las opciones de reciclaje del material de embalaje de su electrodoméstico. INFORMACIÓN REGLAMENTARIA Declaración de conformidad FCC/IC: (VWHGLVSRVLWLYRFXPSOHFRQOD3DUWHGHOD1RUPDWLYDGHOD)&&6XIXQFLRQDPLHQWRHVWiVXMHWRDODVGRVFRQGLFLRQHV VLJXLHQWHV 1. Este dispositivo no deberá causar interferencias nocivas, y 2. Este dispositivo deberá aceptar cualquier interferencia recibida, incluyendo interferencias que puedan generar un funcionamiento no deseado. ATENCIÓN (NOTICE): Los cambios o modificaciones realizados en esta unidad que no hayan sido expresamente aprobados por el fabricante pueden anular la autoridad del usuario para operar el equipo. ADVERTENCIA HQDOJXQRVPRGHORV Este horno puede estar equipado con un micrófono para permitir el control por voz de las operaciones de su horno. Al habilitar el uso del micrófono, este podrá escuchar ciertos comandos de voz para activar y operar el horno en todo momento. Es posible que ruidos de fondo o ambientales imiten palabras o sonidos que este electrodoméstico reconozca como una instrucción, y la unidad podría activarse o iniciar una función o modo de cocción como resultado, incluso cuando la unidad esté desatendida y no se desee la activación de la función o modo de cocción. 1XQFDDOPDFHQHDUWtFXORVLQIODPDEOHVRVHQVLEOHVDODWHPSHUDWXUDHQHOLQWHULRUGHOHOHFWURGRPpVWLFR 6 49-2003957 Rev. 0 Conectividad Wi-Fi Su electrodoméstico está diseñado para proporcionarle comunicación bidireccional entre su electrodoméstico y dispositivos inteligentes. Además, este electrodoméstico puede requerir una actualización de software para habilitar todas las funciones durante la configuración inicial. Al utilizar la aplicación móvil SmartHQ™, usted podrá conectarse a una YDULHGDGGHIXQFLRQHV LQFOX\HQGRHQWUHRWUDVHOXVRGHVX electrodoméstico como altavoz inteligente con Amazon Alexa) y utilizando su teléfono inteligente o tableta*. Visite su tienda de aplicaciones y descargue Smart HQ o utilice el código QR TXHDSDUHFHDFRQWLQXDFLyQ 3DUDFRQHFWDUVXHOHFWURGRPpVWLFRD:L)LVLJDODV indicaciones en la pantalla de controles del electrodoméstico. 3DUDREWHQHUODPHMRUH[SHULHQFLDDQWHVGHFRPHQ]DU 'HVFDUJXHODDSOLFDFLyQ6PDUW+4 6PDUW+4 \DFFHGDR cree una cuenta. NOTA: Los nuevos usuarios deben verificar su dirección de correo electrónico para completar el proceso de inicio de sesión. 7HQJDGLVSRQLEOHODFRQWUDVHxDGHVXUHG:L)LGRPpVWLFD 6LVHUHTXLHUHXQ0$&,'SDUDFRQHFWDUVXHOHFWURGRPpVWLFR D:L)LFRQVXOWHODVHFFLyQ&RQILJXUDFLyQSDUDREWHQHU detalles. También puede consultar la etiqueta de información del electrodoméstico conectado, que normalmente se encuentra en el interior de la puerta del horno o del cajón. 7DPELpQFRQWHQGUiHO1RPEUHGH5HGGHO(OHFWURGRPpVWLFR\ la Contraseña, en caso de ser necesarios. 8QDYH]TXHVXHOHFWURGRPpVWLFRHVWpFRQHFWDGRLQLFLHOD aplicación SmartHQ y toque su electrodoméstico para explorar. Aplique todas las actualizaciones de software si se le solicita para asegurarse de que su electrodoméstico cuente con las funciones más recientes. NOTA: $VHJ~UHVHGHPDQWHQHUDFWLYDGDODIXQFLyQ:L)L para poder controlar su electrodoméstico desde la aplicación SmartHQ. Si tiene problemas con el proceso de conexión, llame al 800.220.6899 y solicite asistencia con la conectividad inalámbrica. * Se requiere un dispositivo Apple o Android compatible y una UHG:L)LGRPpVWLFD Desactivación del Wi-Fi 6LGLVSRQHGHXQERWyQ5HPRWH(QDEOH +DELOLWDUFRQWURO UHPRWR R:L)L&RQQHFW &RQH[LyQ:L)L PDQWHQJD presionado el botón durante 3 segundos para desconectarse FRPSOHWDPHQWHGHO:L)L6LQRWLHQHXQERWyQHQVXV controles, diríjase a Configuración y seleccione desconectar XROYLGDUUHGSDUDGHVFRQHFWDUVHFRPSOHWDPHQWHGHO:L)L 127$'HEHUiYROYHUDFRQHFWDUODDSOLFDFLyQ6PDUW+4D su electrodoméstico si desea controlar su electrodoméstico desde su teléfono nuevamente. Tenga en cuenta que cuando HO:L)LHVWiGHVDFWLYDGRODSODFD:L)LGHOKRUQRQRHVWi transmitiendo. Funciones disponibles Siga todas las instrucciones en la aplicación para el funcionamiento correcto del electrodoméstico al utilizar funciones conectadas. Control remoto del horno: 3DUDKDELOLWDUHOFRQWUROGH6PDUW+4 6PDUW+4 GHOKRUQR PLHQWUDVHO:L)LHVWiDFWLYRDVHJ~UHVHGHTXHODIXQFLyQ esté activada verificando la configuración de remote enable KDELOLWDFLyQUHPRWD HQ&RQILJXUDFLyQ 6HWWLQJV Activación por voz: 8VWHGWLHQHODSRVLELOLGDGGHFRQWURODUHOIXQFLRQDPLHQWRGHVX horno únicamente con su voz. 8VWHGSXHGHXVDUVXYR]SDUDHQFHQGHUXQKRUQR\ORV temporizadores del horno o apagar un horno. Asegúrese GHTXHVXKRUQRHVWpFRQHFWDGRD:L)LFRQHFWDGRDOD aplicación SmartHQ, que la función oven remote enable DFFHVRUHPRWRGHOKRUQR HVWpDFWLYDGD\TXHHOFRQWURO del horno esté desbloqueado. Además, asegúrese de estar conectado a un altavoz inteligente Amazon Alexa y que el altavoz inteligente esté lo suficientemente cerca de su horno para que escuche sus comandos. NOTA: Algunos funciones y características de cocción no HVWDUiQGLVSRQLEOHVKDVWDTXHFRQHFWHVXKRUQRQXHYRDO:L)L de su red hogareña local inalámbrica. Siga las instrucciones anteriores para conectar. Esto brindará capacidad para el uso de las funciones de la aplicación SmartHQ y asegurará que el horno cuenta con el software más reciente. Contains FCC: UPD ID: PT. NO. Contains IC: MAC ID: Connected Appliance Information USO DEL ELECTRODOMÉSTICO: &RQHFWLYLGDG:L)L 49-2003957 Rev. 0 7 Pantalla del Electrodoméstico PANTALLA DE INICIO 1 - Control del Horno 8ELFDGRFRPSOHWDPHQWHDODL]TXLHUGDHQOD3DQWDOODGH,QLFLR del Horno. Asegúrese de deslizar completamente hacia la izquierda si no se muestra cuando la Pantalla del Horno se activa. Horno Superior y Horno Inferior 8VWHGSXHGHXVDUGLIHUHQWHVPRGRVGHFRFFLyQHQFDGDKRUQR Primero seleccione el horno que desea usar y luego seleccione el modo de cocción deseado. Pantalla de Selección de Modo de Cocción Seleccione su preferencia de cocción en esta área. Puede seleccionar entre modos tradicionales del horno o modos de precisión del horno. Consulte la sección de Modos de Cocción para obtener más detalles sobre los diferentes modos de cocción tradicionales y de precisión disponibles. Asegúrese de conectar su horno para que pueda descargar nuevos modos de cocción de precisión a medida que estén disponibles. 2 - Menú Rápido de Configuración 'HVOLFHHVWHPHQ~KDFLDDEDMRSDUDDFFHGHUDODVOXFHVGHO KRUQREORTXHRGHFRQWUROHVPLFUyIRQR HQDOJXQRVPRGHORV altavoces, brillo de la pantalla, diseño del menú Ambiente, alertas y configuraciones. Oven Light (Luz del Horno) Para encender o apagar las luces de la cavidad del horno, presione el . Bloquear controles Seleccione esta opción para bloquear el control del horno y evitar selecciones no deseadas en la pantalla. Para bloquear, presione el botón . Mantenga presionado el botón . para desbloquear. Brillo 8WLOLFHODEDUUDGHVOL]DQWHSDUDDMXVWDUHOEULOORGHODSDQWDOODDO nivel deseado. Ambiente Presione el botón Ambient (Ambiente) para ir directamente a ODSDQWDOOD$PELHQW $PELHQWH Configuración Presione el botón Settings (Configuración) para acceder DOPHQ~6HWWLQJV &RQILJXUDFLyQ &RQVXOWHODVHFFLyQGH Configuración para ver la lista completa de lo que está disponible. My Oven Oven Meal Planning Stay Informed Tools 1:59 PM 1 2 3 4 5 USO DEL ELECTRODOMÉSTICO: Pantalla del Electrodoméstico 8 49-2003957 Rev. 0 Pantalla del Electrodoméstico PANTALLA DE INICIO (Cont.) 3 - Barra de estado En la esquina superior derecha, se muestran las alertas DFWLYDVHOHVWDGRGHOPLFUyIRQR HQDOJXQRVPRGHORV HO HVWDGRGH:L)L\ODKRUD8WLOLFHHVWRFRPRUHIHUHQFLDUiSLGD al usar el horno. 4 - Barra de navegación Flecha de retroceso Esto le lleva una pantalla atrás hasta llegar a la pantalla de inicio. Botón de inicio Le lleva directamente a la pantalla de inicio con la sección de control del horno visible. Botón de horno / Botones de horno Esto le lleva a la pantalla del horno mostrando lo que está en funcionamiento si el horno está en uso. Si el horno seleccionado no está en uso, le llevará a la pantalla de selección de modo para el horno seleccionado. Barra de actividad 8ELFDGDHQODSDUWHLQIHULRUGHODSDQWDOODGHO electrodoméstico, esta barra indica que el horno está encendido en este momento. Esta barra no se muestra cuando el horno está apagado. Esta función solo se muestra cuando el horno está encendido. 5 - Aplicaciones Conecte su horno para aprovechar toda la funcionalidad de las aplicaciones en su control. Algunas aplicaciones solo SXHGHQXVDUVHVLVXKRUQRHVWiFRQHFWDGRD:L)L(MHPSORV de aplicaciones incluyen el clima y el temporizador de cocina. 'HVOLFHKDFLDODGHUHFKDSDUDDFFHGHUDPiVDSOLFDFLRQHV DVtFRPRDODVLVWHQWH6PDUW+4 VRORHQPRGHORVFRQ micrófono) y a la información de Consejos del horno. Temporizadores La aplicación de temporizador funciona como un temporizador de cuenta regresiva. Seleccione " Add a Timer Agregar un temporizador ), HVWDEOH]FDODGXUDFLyQGHOWHPSRUL]DGRUHQVHJXQGRVPLQXWRV horas, asigne un nombre al temporizador si desea reutilizarlo, OXHJRLQLFLHHOWHPSRUL]DGRU8QDYH]LQLFLDGRXQWHPSRUL]DGRU no se puede cambiar el nombre del temporizador. Se pueden configurar y reutilizar varios temporizadores de forma independiente o al mismo tiempo. La pantalla del electrodoméstico le notificará cuando un temporizador haya finalizado. Si se configuran más de dos temporizadores al mismo tiempo, los dos temporizadores configurados más recientemente se mostrarán en la sección Apps. Para ver todos los temporizadores activos y todos los temporizadores previamente configurados, seleccione la aplicación Timer (temporizador) para acceder a la lista y deslice para ver los temporizadores activos, reutilizar un temporizador o eliminar un temporizador. La pantalla del electrodoméstico le notificará cuando un temporizador haya finalizado. USO DEL ELECTRODOMÉSTICO: Pantalla del Electrodoméstico 49-2003957 Rev. 0 9 Settings (Configuraciones) Set Clock (Configuración del Reloj) (VWDIXQFLyQ VRORGLVSRQLEOHFXDQGRQRHVWiFRQHFWDGR OH permite configurar el reloj y especifica cómo la hora del día será exhibida. Las opciones para mostrar la hora son el horario de un reloj estándar de 12 horas con selecciones AM y PM o de estilo militar de 24 horas. Sonidos y alertas Esta pantalla de configuración le permite cambiar el volumen, la alerta de fin de ciclo y activar o desactivar el sonido táctil. Pantalla y apariencia Esta pantalla muestra las opciones de brillo y Ahorro de energía. Configuración del Electrodoméstico Ŷ UNIDADES DE TEMPERATURA: El horno está configurado en grados Fahrenheit; sin embargo, en esta configuración la unidad de cocción puede ser cambiada a Celsius. Ŷ AJUSTA LA TEMPERATURA DEL HORNO: Esta función ajusta la temperatura del horno permite ajustar la temperatura del horno hasta 35 °F más caliente o hasta )PiVIUtD8VHHVWDIXQFLyQVLFRQVLGHUDTXHOD temperatura de su horno está demasiado caliente o fría y desea modificarla. Para los modelos con horno doble, las temperaturas de los hornos superior e inferior se ajustan de IRUPDVHSDUDGD1RXVHWHUPyPHWURVWDOHVFRPRORVTXH se encuentran en tiendas, para controlar la configuración de temperatura del horno. Estos termómetros pueden variar entre 20 y 40 grados. Ŷ CONVERSIÓN AUTOMÁTICA DE RECETAS:: La IXQFLyQ$XWR5HFLSH&RQYHUVLRQ &RQYHUVLyQGH Receta Automática) puede ser activada a fin de reducir automáticamente la temperatura de cocción programada SDUD&RQYHFWLRQ%DNH +RUQHDUSRU&RQYHFFLyQ R &RQYHFWLRQ%DNH0XOWL +RUQHDUSRU&RQYHFFLyQ0~OWLSOH Observe que esto no reducirá la temperatura de cocción, ni el tiempo de horneado. Ŷ APAGADO AUTOMÁTICO A LAS 12 HORAS: Cuando la RSFLyQGH+RXU6KXW2II $SDJDGR/XHJRGH+RUDV sea activada, la misma se apagará de forma automática luego de 12 horas de uso continuo. Ŷ TIEMPO DE APAGADO DE LA LUZ DEL HORNO: Active esta función para que la luz del horno se apague automáticamente después de finalizar la cocción y apagar el horno. Cuenta SmarTHQ Le permite iniciar sesión en su cuenta SmartHQ en su horno. Esta función también ayuda a conectar su horno a su cuenta SmartHQ. Wi-Fi /HSHUPLWHFRQHFWDUVHRHOLPLQDUVXUHG:L)L Activación Remota Active esta función para controlar su horno de forma remota mediante la aplicación, el micrófono o comandos de voz una vez que su horno esté conectado. Modo Ambiente L e permite configurar la pantalla ambiental. Sistema Esta pantalla le permite borrar sus datos de usuario guardados \PXHVWUDODYHUVLyQVDFWXDOGHOVRIWZDUH\HO,'0$& USO DEL ELECTRODOMÉSTICO: 6HWWLQJV &RQILJXUDFLRQHV 10 49-2003957 Rev. 0 Settings (Configuraciones) Modo Sabbath 6XHVWXIDRIUHFHXQPRGR6DEEDWKTXHFXPSOHFRQORVHVWiQGDUHVHVWDEOHFLGRVSRU2UWKRGR[8QLRQHO&HQWUDO5DEELQLFDO Congress y Halacha Tech, y está 100 % certificado según los estándares halájicos más estrictos. En este modo, las luces del horno permanecerán apagadas durante el uso y los tonos del horno estarán desactivados. NOTA: Asegúrese de que el reloj del horno esté ajustado correctamente antes de ingresar al modo. Para un funcionamiento adecuado durante el Sabbath, el modo debe iniciarse dentro de la ventana de 1 hora antes del atardecer. Uso del Modo Sabbath 1DYHJXHDOPHQ~ Settings (Configuración) y seleccione Sabbath (Sabbath) . 6HOHFFLRQHODFRPELQDFLyQGHVHDGDGH6DEEDWK0RGH 0RGR 6DEEDWK R+ROLGD\0RGH 0RGR)HVWLYR GHODVRSFLRQHV proporcionadas y pulse Start (Inicio) . La pantalla indicará qué modo Sabbath o Festivo está en funcionamiento. /DVRSFLRQHVFRQ+ROLGD\ )HVWLYR \6DEEDWK 6DEEDWK cambiarán automáticamente entre las funciones según la hora inicial ingresada dentro de la ventana de 1 hora antes del atardecer. 3DUDODVRSFLRQHVGH6DEEDWK:DUP &DOHQWDUHQ6DEEDWK de menos de 24 horas, el electrodoméstico completará la IXQFLyQ6DEEDWK:DUP &DOHQWDU6DEEDWK \SDVDUiD6DEEDWK ,GOH 5HSRVR6DEEDWK SRUHOUHVWRGHOSHUtRGRGHKRUDV Las luces del horno permanecerán apagadas, los tonos del horno seguirán desactivados, la calefacción del horno estará desactivada y la pantalla mostrará el horno en reposo. Corte de energía en modo Sabbath Si ocurre un corte de energía durante el uso de los modos 6DEEDWK:DUP &DOHQWDUHQ6DEEDWK R+ROLGD\ )HVWLYR HOHOHFWURGRPpVWLFRYROYHUiD6DEEDWK:DUP &DOHQWDU en Sabbath) por el resto del horario seleccionado. Si el FRUWHRFXUUHGXUDQWH6DEEDWK,GOH 5HSRVRHQ6DEEDWK HO HOHFWURGRPpVWLFRYROYHUiD6DEEDWK,GOH 5HSRVRHQ6DEEDWK por el resto del horario seleccionado. Sabbath Warm Temperature (Temperatura de Mantenimiento Sabático) 8WLOLFHODRSFLyQ6HWWLQJV &RQILJXUDFLyQ 6DEEDWK:DUPHU &DOHQWDGRU6DEEDWK SDUDDXPHQWDUODWHPSHUDWXUDGH 6DEEDWK:DUP &DOHQWDU6DEEDWK VLHOKRUQRHVWiIXQFLRQDQGR a una temperatura inferior a la deseada o si su horno opera a 208 voltios. Vaya a Appliance Settings (Configuración) , seleccione Sabbath Warm Temperature (Temperatura de Mantenimiento Sabático) . USO DEL ELECTRODOMÉSTICO: Modo Sabbath 49-2003957 Rev. 0 11 Estantes del Horno USO DEL ELECTRODOMÉSTICO: Estantes del Horno En la Guía de Cocción, se brindan recomendaciones de posiciones de los estantes para diferentes tipos de comidas. Se ajusta un estante en una dirección para afectar los resultados de cocción. Por ejemplo, si se prefieren partes superiores más oscuras en tartas, panecillos o galletas, pruebe moviendo la comida a un estante que se encuentre una posición más arriba. Si encuentra que las comidas están demasiado doradas en la parte superior, pruebe moviendo las mismas más abajo la próxima vez. Al hornear con múltiples ollas y en múltiples estantes, asegúrese de que haya suficiente espacio entre las ollas para que fluya el aire. Para evitar posibles quemaduras, coloque los estantes en la posición deseada antes de encender el horno. Para Cargas Altas en el Horno Inferior Retire los estantes extensibles del horno. Coloque el estante provisto en la parte inferior del horno como se muestra. Observe que este estante no se deslizará sobre las guías a los costados del horno. Estantes Extensibles Siempre empuje hacia afuera el estante desde el riel frontal superior hasta la posición de detención en su máxima extensión, al colocar o retirar utensilios. Los estantes extensibles no podrán ser usados en la posición del estante superior. Si resulta difícil extender los estantes extensibles, lubríquelos según lo indicado en la sección de Cuidado y Limpieza de este manual. Para Retirar un Estante Extensible: 1. Asegúrese de introducir la parrilla hasta el fondo del horno, de modo que las paletas laterales del armazón de la parrilla se desenganchen de la cavidad. 'HVOLFHODSDUULOODKDFLDXVWHGKDVWDTXHOOHJXHDOWRSH SRVLFLyQGHWHQLGD GHOVRSRUWHGHODSDUULOOD 3. Tome de manera firme ambos lados de la estructura del estante y deslizando este último, incline el extremo del frente hacia arriba y empuje hacia fuera. Para Reemplazar un Estante Extensible: 1. Tome firmemente ambos lados del armazón de la parrilla y la parrilla deslizable. 2. Coloque el extremo curvo del estante en la posición deseada, incline el frente hacia arriba y presione la parrilla hacia adentro. Si resulta difícil reemplazar o retirar los estantes extensibles, coloque un poco de aceite vegetal en una tela suave o una toalla de papel y limpie los soportes de los estantes del horno. 1RTXLWHHODFHLWHGHFRFLQDGHOHVSDFLRGHGHVOL]DPLHQWR NOTA: El uso de otros aceites de cocina como aceite de cacahuate, Pam® u otros aerosoles lubricantes puede provocar una descoloración o un residuo de color similar al óxido en los estantes y los laterales de las cavidades. Para limpiar este residuo, use agua y jabón o una solución de vinagre y agua. Enjuague con agua limpia y seque con una tela seca. Riel frontal superior Posición de apertura total Tomar aquí 3 2 1 Piso 12 49-2003957 Rev. 0 PRECAUCIÓN No use ningún tipo de aluminio o cobertor de horno para cubrir el fondo del horno. Estos ítems pueden atrapar el calor o derretirse, ocasionando daños sobre el producto y el riesgo de descargas, humo o incendios. Los daños por uso inadecuado de estos ítems no están cubiertos por la garantía del producto. Se podrá usar aluminio para evitar derrames, colocando una hoja sobre un estante inferior varias pulgadas debajo de la comida. 1RXVHPiVDOXPLQLRTXHHOQHFHVDULR\QXQFDFXEUDWRWDOPHQWHHOHVWDQWHGHXQKRUQRFRQSDSHOGHDOXPLQLR0DQWHQJDHO aluminio a por lo menos 1 1/2” de las paredes del horno, para evitar una circulación deficiente del calor. Papel de Aluminio y Cobertores del Horno Guía para Utensilios de Cocina Pautas de Uso de Utensilios El material, el acabado y el tamaño de los utensilios afectan el horneado. Las ollas oscuras, revestidas y opacas absorben el calor más rápidamente que las ollas claras y brillantes. Al usar ollas que absorben el calor más rápidamente, las comidas podrán resultar más doradas, crocantes y con una capa más gruesa. Si utiliza utensilios oscuros y revestidos, controle la comida antes del tiempo mínimo de cocción. Si se obtienen resultados no deseados con este tipo de utensilios, considere la posibilidad de reducir la temperatura del horno en 25º F la próxima vez. Las ollas brillantes pueden producir resultados de horneado más parejos en tortas y galletas. Las ollas de vidrio y cerámica calientan con lentitud, pero retienen bien el calor. Estos tipos de ollas funcionan bien con platos tales como tartas y postres con natilla. Las ollas con aislante de aire calientan lentamente y pueden producir fondos dorados. Mantenga los utensilios limpios para una cocción más pareja. El utensilio usado en los modos para asar y freír con aire deberá ser de uso seguro para asar. USO DEL ELECTRODOMÉSTICO: 3DSHOGH$OXPLQLR\&REHUWRUHVGHO+RUQR8WHQVLOLRV 49-2003957 Rev. 0 13 Modos de Cocción USO DEL ELECTRODOMÉSTICO: Modos de Cocción Su nuevo horno posee una variedad de modos de cocción para que pueda obtener los mejores resultados. Estos modos se describen a continuación. Consulte la sección Guía de cocción para recomendaciones sobre alimentos específicos y revise el menú de opciones de cocción en la pantalla del electrodoméstico para obtener consejos de cocción y otras recomendaciones al configurar un modo de horno. Recuerde que es posible que su nuevo horno funcione de manera diferente que aquel que está reemplazando. Modos de Horneado y Dorado Seleccione un modo para hornear y dorar basado en el tipo y cantidad de comida que está preparando. Al preparar comidas horneadas tales como tartas, galletas y masas, siempre precaliente el horno primero. Siga las recomendaciones de la receta sobre la colocación de la comida. Si no se brindan pautas, centre la comida en el horno. Hornear El modo de horneado está pensado para la cocción en un solo estante. Este modo usa el calor principalmente desde el elemento inferior, pero también desde el elemento superior para cocinar la comida. Para usar este modo, presione la tecla Bake (Hornear) , ingrese una temperatura, y luego presione Start (Iniciar) . El precalentamiento generalmente se recomienda al usar este modo. Honeado por Convección en Estantes Múltiples (en algunos modelos/hornos) (OPRGR&RQYHFWLRQ%DNH0XOWL5DFN +RQHDGRSRU Convección en Estantes Múltiples) está pensado para honear en múltiples estantes al mismo tiempo. Este modo utiliza el calor principalmente desde el elemento trasero, pero también calienta desde los elementos superior e inferior, junto con el movimiento de aire desde el ventilador por convección para mejorar una cocción pareja. El horno está equipado con ODIXQFLyQ$XWR5HFLSH&RQYHUVLRQ &RQYHUVLyQGH5HFHWD Automática); de modo que no es necesario convertir la temperatura al usar este modo. Es posible que el tiempo de horneado sea un poco más prolongado con estantes múltiples, en comparación con lo que se espera con un solo estante. Para usar este modo, presione Convection Bake Multi Rack (Hornear por convección en varias rejillas) , ingrese una temperatura, y luego presione Start (Iniciar) . Siempre realice el precalentamiento al usar este modo. Dorado por Convección (en algunos modelos/hornos) (OPRGRGH$VDGRSRU&RQYHFFLyQ &RQYHFWLRQ5RDVW HVWi diseñado para asar carnes y verduras en una sola rejilla. Este modo utiliza calor de los elementos inferior, superior y trasero junto con el movimiento de aire para mejorar el dorado \UHGXFLUHOWLHPSRGHFRFFLyQ1RHVQHFHVDULRFRQYHUWLU la temperatura. Cuando use este modo, o si usa la sonda, controle la comida antes que el tiempo sugerido en la receta. Para usar este modo, presione la Convection Roast (Asar por convección), ingrese una temperatura, y luego presione Start (Iniciar) 1RHVQHFHVDULRUHDOL]DUHOSUHFDOHQWDPLHQWRDO usar este modo. Modo para Asar Siempre ase con la puerta cerrada. El elemento para asar en el horno es muy potente. Monitoree la comida de cerca al asar. Tenga cuidado al asar en posiciones de estantes superiores, ya que colocar la comida más cerca del elemento para asar incrementa el humo, salpicaduras y la posibilidad de que se LQFHQGLHQODVJUDVDV1RVHUHFRPLHQGDDVDUHQODSRVLFLyQ superior del estante. Intente asar las comidas que normalmente haría a la parrilla. Ajuste las posiciones de los estantes para ajustar la intensidad del calor a la comida. Coloque las comidas más cerca del elemento para asar, cuando se desee una superficie más cocinada y un interior poco cocido. Las comidas más gruesas y las comidas cuyo interior debe ser cocinado deberían ser asadas en un estante en una posición alejada del usado SDUDDVDURXVDQGRODVIXQFLRQHV7UDGLFLRQDO%URLO/R $VDGR 7UDGLFLRQDO%DMR R&RQYHFWLRQ%URLO/R $VDGRSRU&RQYHFFLyQ Bajo). Para un mejor rendimiento, centre la comida debajo del elemento calentador para asar. Broil (Asar a la parrilla) (OPRGR%URLO+LJK $VDGR$OWR XVDFDORULQWHQVRGHOHOHPHQWR VXSHULRUSDUDVRDVDUODVFRPLGDV8VHODIXQFLyQ%URLO+LJK $VDGR$OWR SDUDFRUWHVPiVGHOJDGRVGHFDUQH\RFRPLGDV que prefiera que quedan menos cocinadas en su interior. Para usar este modo presione Broil (Asar) , luego seleccione High (Alto) o Low (Bajo) según la cantidad de sellado y la temperatura interna que prefiera, y luego presione Start (Iniciar) . 1RHVQHFHVDULRUHDOL]DUHOSUHFDOHQWDPLHQWRDOXVDU este modo. 14 49-2003957 Rev. 0 Modos de Cocción (Cont.) USO DEL ELECTRODOMÉSTICO: Modos de Cocción Fritura con Aire (en algunos modelos/hornos) $LU)U\ )UHtUFRQ$LUH HVXQPRGRGHFRFFLyQHVSHFLDOSRU convección sin precalentamiento, diseñado para producir comidas con un exterior más crocante que en cocciones con KRUQRVWUDGLFLRQDOHV(OPRGR$LU)U\ )UHtUFRQ$LUH IXH diseñado para la cocción en un solo estante únicamente. Seleccione Air Fry (Freír con Aire) , y luego ingrese la configuración de temperatura deseada y presione Start (Iniciar) . La temperatura se podrá configurar entre 300°F y )1RHVQHFHVDULRHOSUHFDOHQWDPLHQWRDOHVWDUHQHVWH modo. Siga las pautas de la receta para hornos tradicionales o del paquete en relación a los ajustes de temperatura y tiempos de cocción; ajuste el tiempo de cocción para lograr la textura crocante deseada. Se podrán encontrar pautas adicionales para utilizar este modo en la Guía de Cocción. este modo. Leudar (OPRGR3URRI /HXGDU HVWiGLVHxDGRSDUDHOHYDU IHUPHQWDU y leudar) masas de pan. Seleccione Proof (leudar ) y luego presione Start (Inicio) . Cubra bien la masa para evitar que se seque. El pan se elevará más rápidamente que a temperatura ambiente. Calentar (OPRGR:DUP &DOHQWDU HVWiGLVHxDGRSDUDPDQWHQHU comidas calientes hasta durante 3 horas. Para usar este modo, seleccione Warm (calentar) y luego presione Start (iniciar) . Cubra las comidas que necesitan mantener la humedad y no FXEUDDTXHOODVFRPLGDVTXHGHEHUtDQTXHGDUFURFDQWHV1R VHUHTXLHUHSUHFDOHQWDUODVPLVPDV1RXVHODIXQFLyQ:DUP &DOHQWDU SDUDFDOHQWDUFRPLGDIUtDH[FHSWRJDOOHWDVFUXMLHQWHV papas fritas o cereales secos. También se recomienda que la comida no se mantenga caliente por más de dos horas. Cocción de Precisión (en algunos modelos/ hornos) &RFFLyQGHSUHFLVLyQ 3UHFLVLRQ&RRNLQJ HVXQDH[SHULHQFLD de cocción guiada diseñada para brindarle el mejor resultado de su horno para alimentos específicos. Cuando usted selecciona un alimento a través del menú Cocción de precisión 3UHFLVLRQ&RRNLQJ0HQX VHVHOHFFLRQDQDXWRPiWLFDPHQWH los ajustes recomendados del horno para ese alimento y se proporciona información adicional para ayudarle a obtener el mejor resultado. Ciclos adicionales estarán disponibles a través de actualizaciones del software. Conecte su horno para tener acceso a estas actualizaciones. Para acceder a detalles sobre FyPRFRQHFWDUVXKRUQRFRQVXOWHODVHFFLyQ:L)L&RQQHFW 49-2003957 Rev. 0 15 USO DEL ELECTRODOMÉSTICO: Modos de Cocción Modos de Cocción (Cont.) Configuración de un modo de cocción 'HVGHODSDQWDOODGHLQLFLRVHOHFFLRQHHOKRUQRFXDQGR utilice un horno doble. Luego seleccione el modo Traditional &RRNLQJ &RFFLyQWUDGLFLRQDO R3UHFLVLRQ&RRNLQJ &RFFLyQGH precisión). 6LXVWHGVHOHFFLRQD3UHFLVLRQ&RRNLQJ FRFFLyQGHSUHFLVLyQ las categorías aparecerán en la parte izquierda de la pantalla y las opciones de comida aparecerán en la parte derecha. 1. Categorías: Los alimentos están agrupados en Categorías. 'HVSOiFHVHKDFLDDUULED\KDFLDDEDMRSDUDYHUWRGDVODV Categorías. Seleccione una Categoría para ver todas las opciones de alimentos dentro de una Categoría en el lado derecho de la pantalla. 2. Alimentos: 'HVSOiFHVHKDFLDODL]TXLHUGD\KDFLDOD derecha para ver todas las opciones de alimentos dentro de una Categoría. Seleccione un alimento en el lado derecho de la pantalla para comenzar la cocción. Categorías y opciones de comida adicionales estarán disponibles mediante actualizaciones de software. Conecte su horno para tener acceso a estas actualizaciones. &RQVXOWHODVHFFLyQGHFRQHFWLYLGDG:L)LSDUDREWHQHU detalles sobre cómo conectar su horno. 1. Categorías 2. Alimentos Precision Cooking 1:59 PM 8QDYH]TXHXVWHGVHOHFFLRQHXQPRGRGHFRFFLyQ7UDGLWLRQDO 7UDGLFLRQDO RXQPRGRGHFRFFLyQ3UHFLVLRQ&RRNLQJ &RFFLyQGH 3UHFLVLyQ ODV&RRNLQJ2SWLRQV 2SFLRQHVGH&RFFLyQ DSDUHFHUiQHQODSDUWHL]TXLHUGDGHODSDQWDOOD\ODLQIRUPDFLyQVREUHODV selecciones aparecerá en el lado derecho de la pantalla. 1. OPCIONES DE COCCIÓN 8QD RSFLyQ GH FRFFLyQ VROR VH PRVWUDUi VL HVWi GLVSRQLEOH R es necesaria para el modo de cocción seleccionado. Si no se muestra una opción de cocción para un modo de cocción seleccionado, entonces no está disponible para su uso o no es necesaria. Tenga en cuenta que cualquier opción de cocción que se muestre para un modo de cocción tendrá selecciones predeterminadas, pero confirme que la configuración y las selecciones predeterminadas coincidan con las entradas TXHXVWHGGHVHD FRPRWHPSHUDWXUDHVWDEOHFLGDWLHPSRGH FRFFLyQWDPDxRRWLSR \HOUHVXOWDGRHVSHUDGR QLYHOGH cocción). Esto es especialmente importante al usar los modos 3UHFLVLRQ&RRNLQJ FRFFLyQGHSUHFLVLyQ Asegúrese de desplazarse hacia arriba y hacia abajo para ver todas las Opciones de cocción disponibles para un modo de cocción seleccionado. Temperatura Al seleccionar una temperatura establecida del horno, se muestran temperaturas preestablecidas que pueden seleccionarse desplazándose horizontalmente y seleccionando la temperatura deseada. La opción para establecer una temperatura de cocción personalizada está disponible usando el teclado numérico. 1RWRGRVORVPRGRVGHFRFFLyQGHSUHFLVLyQUHTXLHUHQTXH usted configure una temperatura de cocción. Temporizador Si el modo de cocción seleccionado admite un temporizador de cocción, esta opción le permite configurar un temporizador de cuenta regresiva que puede programarse para apagar o no apagar el modo de cocción cuando el temporizador finaliza. Algunos modos de cocción de precisión tienen un temporizador configurado automáticamente. En estos casos, la opción Temporizador no se muestra. En su lugar, la cuenta regresiva del temporizador comienza después de presionar Start (Inicio). Este temporizador no apagará el horno cuando finalice el tiempo. Sonda Esta opción se muestra si la sonda del horno puede usarse con un modo de horno tradicional. Consulte la sección Sonda para obtener detalles sobre el uso de la sonda del horno. Algunos modos de cocción de precisión requieren el uso de la sonda para horno provista con el horno. Para estos ciclos, se proporcionan instrucciones de colocación de la sonda, pero la temperatura establecida de la sonda la determina el modo de cocción de precisión seleccionado. Ajuste rápido de tono Barra de navegación Barra de estado Teclado numérico 2.Información o selecciones 1. Opciones de cocción Cooking Mode Start 1:59 PM 3. 16 49-2003957 Rev. 0 Modos de Cocción (Cont.) USO DEL ELECTRODOMÉSTICO: Modos de Cocción Configuración de un modo de cocción (cont.) 1. OPCIONES DE COCCIÓN (cont.) Consejos de cocción Esta opción proporciona información útil adaptada al modo de cocción seleccionado. Esto puede incluir consejos sobre cómo preparar los alimentos para la cocción, cómo el utensilio de cocina puede afectar los resultados de cocción o cómo ayudar a evitar derrames en la cavidad del horno. Parrilla y utensilios de cocina 3DUDDOJXQRVPRGRVGH3UHFLVLRQFRRNLQJ FRFFLyQGH precisión), esta opción brinda sugerencias sobre la ubicación de la parrilla y los utensilios de cocina adaptadas al modo seleccionado. Cantidad de parrillas 3DUDDOJXQRVPRGRVGH3UHFLVLRQFRRNLQJ FRFFLyQGH SUHFLVLyQ SURGXFWRVKRUQHDGRVFRPRJDOOHWDVSRUHMHPSOR esto proporciona opciones de cocción para cocinar en una sola parrilla o en varias parrillas. Si esta opción no se muestra, se espera que usted cocine en una sola parrilla. Nivel de cocción 3DUDDOJXQRVPRGRVGH3UHFLVLRQFRRNLQJ FRFFLyQGH SUHFLVLyQ FRPRELVWHFVRWRFLQR HVWDRSFLyQUHTXLHUHTXH usted elija el nivel de cocción deseado para el alimento seleccionado. Algunos alimentos con opciones de nivel de cocción requieren la sonda, mientras que otros dependen del tiempo de cocción. Cuando se selecciona una opción de nivel de cocción, el objetivo de la sonda o el tiempo de cocción, así como las condiciones de cocción del horno, se actualizan según la selección de alimento realizada. Tamaño 3DUDDOJXQRVPRGRVGH3UHFLVLRQFRRNLQJ FRFFLyQGHSUHFLVLyQ FRPRVDOPyQ HVWDRSFLyQUHTXLHUHTXHXVWHGHOLMDGHXQDOLVWD de selecciones para adaptar las condiciones de cocción y el tiempo de cocción según las selecciones realizadas. Tipo 3DUDDOJXQRVPRGRVGH3UHFLVLRQFRRNLQJ FRFFLyQGH SUHFLVLyQ FRPRWRFLQR HVWDRSFLyQUHTXLHUHTXHXVWHGHOLMD GHXQDOLVWDGHVHOHFFLRQHV FRPRJUXHVRUHJXODURFRUWH central para tocino) para adaptar las condiciones de cocción y el tiempo de cocción según las selecciones realizadas. 2. INFORMACIÓN O SELECCIONES El contenido en esta área varía según la opción activa seleccionada a la izquierda. Asegúrese de deslizar hacia la izquierda y la derecha en esta área para ver todo el contenido relevante. Puede haber recomendaciones de utensilios de cocina o consejos adicionales para consultar. 3. INICIO Revise la configuración de las opciones de cocción, sus selecciones y coloque los estantes del horno antes de presionar Start (Inicio). 49-2003957 Rev. 0 17 Probe (Sonda) (en algunos modelos) La temperatura interna de la comida con frecuencia se usa como indicador de que está lista, especialmente al dorar o preparar FDUQHGHDYH(OPRGR3UREH 6RQGD PRQLWRUHDODWHPSHUDWXUDLQWHUQDGHODFRPLGD\DSDJDHOKRUQRFXDQGRHVWD~OWLPD alcanza la temperatura programada. ADVERTENCIA El consumo de comida semicruda puede hacer que se contraigan enfermedades producidas por la comida. Use la sonda de acuerdo con las siguientes instrucciones, a fin de asegurar que todas las partes de la comida alcancen temperaturas de cocción mínimamente seguras. Las recomendaciones de temperatura mínima segura para los alimentos son proporcionadas por el USDA y la FDA. Controle siempre la temperatura en múltiples partes de la comida, utilizando un termómetro de comidas luego de realizar la cocción, a fin de asegurar que todas las partes de la misma hayan alcanzado una temperatura interna mínimamente segura en dicha comida. Ubicación Correcta de la Sonda Luego de preparar la comida y de colocarla en la olla, siga estas instrucciones para una ubicación correcta de la sonda. Ŷ ,QVHUWHODVRQGDHQODFRPLGDGHPRGRTXHODSXQWDGH la sonda se apoye en el centro de la parte más gruesa de la comida. Para un mejor rendimiento, la sonda debería ser completamente insertada en la comida. Si la sonda no es ubicada correctamente, es posible que no mida con precisión la temperatura de la parte más fría de la comida. Algunas comidas, particularmente las más pequeñas, no son adecuadas para la cocción con el uso de una sonda, debido a sus formas o tamaños. Ŷ 1RGHEHUtDWRFDUHOKXHVRODJUDVDQLHOFDUWtODJR Ŷ 3DUDFRFLQDUXQDYHHQWHUDLQVHUWHODVRQGDHQODSDUWH más gruesa de la pechuga. Ŷ 3DUDGRUDUVLQKXHVRVLQVHUWHODVRQGDHQHOFHQWURGHO dorado. Ŷ 3DUDFRFLQDUMDPyQRFRUGHURFRQKXHVRVLQVHUWHODVRQGD en el centro de la articulación o del músculo más bajo y largo. Ŷ 3DUDSUHSDUDUFD]XHODVRSODWRVWDOHVFRPRSDVWHOGH carne, inserte la sonda en el centro del plato. Ŷ 3DUDFRFLQDUSHVFDGRLQVHUWHODVRQGDMXVWRDUULEDGHOD agalla en la zona más carnosa paralela a columna. Uso de la Sonda Para usar la sonda: ,QVHUWHODVRQGDHQODFRPLGD FRQVXOWHVREUHOD8ELFDFLyQ Correcta de la Sonda). 2. Coloque la comida en el horno y conecte la sonda en el tomacorriente correspondiente del o de los hornos. NOTA: /DVRQGDQRSXHGHXWLOL]DUVHGXUDQWHDVDU EURLO DVDU SRUFRQYHFFLyQ FRQYHFWLRQEURLO GHVKLGUDWDU GHK\GUDWH PDQWHQHUFDOLHQWH ZDUP IHUPHQWDU SURRI 3. Seleccione el modo y la temperatura de cocción deseados. Si el modo de cocción es compatible con el uso de una sonda, se visualizará la pantalla de configuración de la sonda. Ingrese la temperatura interna deseada para la comida y presione Start ,QLFLDU /DWHPSHUDWXUDGHOD sonda se puede configurar entre 100°F y 200°F. NOTA: Si se desea precalentar, complete este paso antes del paso 1. /RVPRGRVGHFRFFLyQWUDGLFLRQDOHV H[FOX\H6ORZ5RDVW finalizan el modo cuando se alcanza la temperatura de la sonda y los modos de Precisión Cooking no lo hacen. Pautas para el Cuidado de la Sonda NOTA: algunos modelos con horno doble cuentan con una sonda sólo en el horno superior. Ŷ 6LVHXVDXQDVRQGDTXHQRVHDODSURYLVWDFRQHVWH producto, se podrán producir daños sobre la sonda. Ŷ 8VHODVPDQLMDVGHODVRQGDDOHQFKXIDU\GHVHQFKXIDUOD misma, luego de insertar o de retirar la sonda de la carne o del tomacorriente. Ŷ 3DUDHYLWDUGDxRVVREUHODVRQGDQRXVHDJDUUDGHUDVSDUD empujar el cable al retirarlo. Ŷ 3DUDHYLWDUURPSHUODVRQGDDVHJ~UHVHGHTXHOD comida haya sido completamente descongelada antes de insertarla. Ŷ 3DUDHYLWDUSRVLEOHVTXHPDGXUDVQRGHVHQFKXIHODVRQGD del tomacorriente del horno hasta que este último se haya enfriado. Ŷ 1XQFDGHMHODVRQGDGHQWURGHOKRUQRGXUDQWHXQFLFORGH limpieza automática o de limpieza con vapor. Ŷ 1RJXDUGHODVRQGDGHQWURGHOKRUQR USO DEL ELECTRODOMÉSTICO: Probe 18 49-2003957 Rev. 0 TIPO DE COMIDA MODO(S) RECOMENDADO(S) POSICIÓN(ES) DE ESTANTES RECOMENDADA SUGERENCIAS ADICIONALES Productos Horneados Tortas con capas, tortas rectangulares, roscas, panecillos, pan rápido en un Solo Estante Horneado Tradicional 1 8VHXWHQVLOLRVEULOODQWHV Galletas, galletitas, bizcochitos Horneado Tradicional 1 8VHXWHQVLOLRVEULOODQWHV Bife y Cerdo Hamburguesas Asar Alto 1 8VHXQDROODSDUDDVDUPXHYDODFRPLGDKDFLDDEDMRSDUDTXHTXHGH más preparada y menos soasada. Preste atención a la comida al asarla. Para un mejor rendimiento, centre la comida debajo del elemento calentador para asar. Bifes y Chuletas Asar Alto 1 8VHXQDROODSDUDDVDUPXHYDODFRPLGDKDFLDDEDMRSDUDTXHTXHGH más preparada y menos soasada. Preste atención a la comida al asarla. Para un mejor rendimiento, centre la comida debajo del elemento calentador para asar. Ave Pechugas, patas, muslos con huesos Horneado Tradicional Asado Bajo 1 Preste atención a la comida al asarla. Para un mejor rendimiento, centre la comida debajo del elemento calentador para asar. Pechugas de pollo deshuesadas Horneado Tradicional Asado Bajo 1 Preste atención a la comida al asarla. Para un mejor rendimiento, centre la comida debajo del elemento calentador para asar. Pescado Asado Bajo 1 Preste atención a la comida al asarla. Para un mejor rendimiento, centre la comida debajo del elemento calentador para asar. Cazuelas Horneado Tradicional 1 Comidas Congeladas a Conveniencia Pizza Horneado Tradicional 1 8VHXWHQVLOLRVEULOODQWHV Productos con papa, patitas de pollo fritas, aperitivos Horneado Tradicional 1 8VHXWHQVLOLRVEULOODQWHVDOXVDUHOKRUQHDGRWUDGLFLRQDO Guía de Cocción - Horno Superior La siguiente tabla brinda algunas pautas para los modos de cocción típicos. /DVUHFRPHQGDFLRQHVPtQLPDVGHWHPSHUDWXUDVHJXUDSDUDORVDOLPHQWRVVRQSURSRUFLRQDGDVSRUHO86'$\OD)'$8WLOLFHXQWHUPyPHWURSDUD alimentos para medir la temperatura y verifique en varios puntos. USO DEL ELECTRODOMÉSTICO: *XtDGH&RFFLyQ+RUQR6XSHULRU 49-2003957 Rev. 0 19 Guía de Cocción - Horno Inferior Las recomendaciones mínimas de temperatura segura para los DOLPHQWRVVRQSURSRUFLRQDGDVSRUHO86'$\OD)'$8WLOLFH un termómetro para alimentos para medir la temperatura y verifique en varios puntos. Al hornear cuatro tortas con capas a la vez, use el estante inferior y el estante de extensión en 2 en la cavidad inferior. Centre las ollas de adelante hacia atrás en los estantes como se muestra. TIPO DE COMIDA MODO(S) RECOMENDADO(S) POSICIÓN(ES) DE ESTANTES RECOMENDADA SUGERENCIAS ADICIONALES Productos Horneados Tortas con capas, tortas rectangulares, roscas, panecillos, pan rápido en un Solo Estante Horneado Tradicional 1 8VHXWHQVLOLRVEULOODQWHV Tortas con capas* en Múltiples Estantes Horneado por Convección Múltiple Piso y 2 ext $VHJ~UHVHGHTXHKD\DXQIOXMRGHDLUHDGHFXDGR 9HDODLOXVWUDFLyQ 7RUWDVGHJUDVD SDVWHOGHiQJHO Horneado Tradicional Piso 8VHXWHQVLOLRVEULOODQWHV Galletas, galletitas, bizcochitos en un Solo Estante Horneado Tradicional 1 8VHXWHQVLOLRVEULOODQWHV Galletas, galletitas, bizcochitos en Múltiples Estantes Horneado por Convección Múltiple Piso y 2 ext Asegúrese de que haya un flujo de aire adecuado. Bife y Cerdo Hamburguesas Asar Alto 2 8VHXQDROODSDUDDVDUPXHYDODFRPLGDKDFLDDEDMRSDUDTXHTXHGH más preparada y menos soasada. Preste atención a la comida al asarla. Para un mejor rendimiento, centre la comida debajo del elemento calentador para asar. Bifes y Chuletas Asar Alto 2 8VHXQDROODSDUDDVDUPXHYDODFRPLGDKDFLDDEDMRSDUDTXHTXHGH más preparada y menos soasada. Preste atención a la comida al asarla. Para un mejor rendimiento, centre la comida debajo del elemento calentador para asar. 'RUDGRV Horneado Tradicional 'RUDGRSRU&RQYHFFLyQ Piso o 1 ext 'HMHVLQFXEULUXVHXQDROODFKDWDWDOFRPRXQDROODSDUDDVDU 1RVHUHTXLHUHSUHFDOHQWDUOD Ave Pollo entero Horneado Tradicional 'RUDGRSRU&RQYHFFLyQ Piso o 1 ext 8VHXQDROODFKDWDWDOFRPRXQDROODSDUDDVDU 1RVHUHTXLHUHSUHFDOHQWDUOD Pechugas, patas, muslos con huesos Asado Bajo Horneado Tradicional 'RUDGRSRU&RQYHFFLyQ 1 Ase del lado de la piel hacia abajo primero. Preste atención a la comida al asarla. Para un mejor rendimiento, centre la comida debajo del elemento calentador para asar. Pechugas de pollo deshuesadas Asado Bajo Horneado Tradicional 'RUDGRSRU&RQYHFFLyQ 1 Mueva la comida más abajo para que quede más preparada y menos soasada y más arriba para soasar/ dorar al asar. Para un mejor rendimiento, centre la comida debajo del elemento calentador para asar. Pavo entero Horneado Tradicional 'RUDGRSRU&RQYHFFLyQ Flo Piso or 8VDXQDROODFKDWDWDOFRPRXQDROODSDUDDVDU 1RVHUHTXLHUHSUHFDOHQWDUOD Pechuga de Pavo Horneado Tradicional 'RUDGRSRU&RQYHFFLyQ Piso o 1 ext 8VHXQDROODFKDWDWDOFRPRXQDROODSDUDDVDU 1RVHUHTXLHUHSUHFDOHQWDUOD Pescado Asado por Convección Bajo Asado Bajo 1 o 2 Preste atención a la comida al asarla. Para un mejor rendimiento, centre la comida debajo del elemento calentador para asar. Cazuelas Horneado Tradicional 1 Comidas Congeladas a Conveniencia Pizza en un estante simple Horneado Tradicional 1 8VHXWHQVLOLRVEULOODQWHV Pizza en estantes múltiples Horneado por Convección Múltiple Piso y 2 ext 8VHXWHQVLOLRVEULOODQWHV Productos con papa, patitas de pollo fritas, aperitivos en un Solo Estante Horneado Tradicional 1 8VHXWHQVLOLRVEULOODQWHVDOXVDUHOKRUQHDGRWUDGLFLRQDO Productos con papa, patitas de pollo fritas, aperitivos en Múltiples Estantes Horneado por Convección Múltiple Piso y 2 ext 8VHXWHQVLOLRVEULOODQWHV&DPELHODXELFDFLyQGHODFRPLGDSDUFLDOPHQWH durante la cocción, a fin de obtener resultados de cocción más parejos. La siguiente tabla brinda algunas pautas para los modos de cocción típicos. Estante del Piso USO DEL ELECTRODOMÉSTICO: *XtDGH&RFFLyQ+RUQR,QIHULRU 20 49-2003957 Rev. 0 Guía de Cocción MODO DE COCCIÓN PARA FREÍR CON AIRE $LU )U\ )UHtU FRQ $LUH HV XQ PRGR GH FRFFLyQ HVSHFLDO VLQ precalentamiento, que fue diseñado para producir comidas que en su exterior queden más crocantes que en la cocción en hornos tradicionales. Seleccione Air Fry (Freír con Aire) y luego ingrese la configuración de temperatura deseada y presione Start (Iniciar). La temperatura se puede configurar entre 300°F and 500°F. Pautas del Utensilio para Freír con Aire 8WLOLFH XWHQVLOLRV GH XVR VHJXUR SDUD DVDU DO XWLOL]DU HO PRGR $LU )U\ )UHtU FRQ $LUH 6H UHFRPLHQGD HO XVR GH XQD EDQGHMD GH OiPLQD RVFXUD 8QD bandeja oscura promueve un mejor dorado y que la comida quede más crocante. • También se podrán usar canastas de horneado en el horno y rejillas de horneado. Se deberá colocar una bandeja plana sobre el estante debajo de las comidas, a fin de atrapar cualquier goteo al usar la canasta de horneado. Consejos Generales sobre el Modo para Freír con Aire (O PRGR $LU )U\ )UHtU FRQ $LUH IXH GLVHxDGR SDUD FRFLQDU HQ un solo estante. (O PRGR $LU )U\ )UHtU FRQ $LUH IXH GLVHxDGR SDUD XQ XVR VLQ pre calentamiento. • Se recomienda la posición del estante 2 para la mayoría de las comidas. Si las comidas se están dorando demasiado rápido, intente usar una posición de estante inferior. • Las comidas se podrán cocinar más rápido de lo esperado si el horno ya está caliente cuando se coloca la comida en el mismo. • Al freír con aire comidas con salsa, se recomienda aplicar esta última al final de la cocción. • Si las comidas se doran demasiado rápido, intente colocar la misma en un estante que se encuentre en un posición más baja o en una configuración de temperatura de horno más baja. • En el caso de comidas empaquetadas, utilice las instrucciones de cocción tradicionales para horno en relación a la configuración de temperatura y tiempos de cocción esperados. 1R HV QHFHVDULR YROWHDU R UHYROYHU OD FRPLGD GXUDQWH OD cocción. 8ELTXH OD FRPLGD HQ XQD VROD FDSD VREUH OD EDQGHMD VLQ sobrecargar la misma. Para obtener los mejores resultados, los alimentos no deben superponerse. • Cocine los alimentos completamente para ayudar a proteger contra enfermedades transmitidas por los alimentos. Las recomendaciones de temperatura mínima segura para los DOLPHQWRV VRQ SURSRUFLRQDGDV SRU HO 86'$ \ OD )'$ 8WLOLFH un termómetro para alimentos para medir la temperatura de los alimentos y verifique en varios lugares. TIPO DE COMIDA POSICIÓN(ES) DE ESTANTES RECOMENDADAS CONFIGURACIÓN DE TEMPERATURA RECOMENDADA (°F) TIEMPO DE COCCIÓN RECOMENDADO (MÍN.) NOTAS Trozos de pescado fresco deshuesado o ave, empanados en forma de patitas, frituras crocantes, filetes Extensión en 2 8VH FRQILJXUDFLRQHV GH WHPSHUDWXUD PiV EDMDV SDUD SLH]DV PiV JUDQGHV 8VH XWHQVLOLRV EULOODQWHV Huesos frescos de alitas de pollo Extensión en 2 Sale las alitas o cubra las mismas con un roce en seco si usará salsa luego de la cocción o hacia el final de la cocción. Huesos frescos de patas o muslos de pollo Extensión en 2 8VH FRQILJXUDFLRQHV GH WHPSHUDWXUD PiV EDMDV SDUD piezas más grandes. Papas fritas frescas y GHOJDGDV ò SXOJDGD Extensión en 2 Se recomienda el uso de papel para hornear al preparar papas fritas frescas. Para frituras más crocantes, mezcle las papas fritas con almidón de maíz o harina de arroz antes de la cocción. Papas fritas frescas y GHOJDGDV ò SXOJDGD Extensión en 2 Se recomienda el uso de papel para hornear al preparar papas fritas frescas. Para frituras más crocantes, mezcle las papas fritas con almidón de maíz o harina de arroz antes de la cocción. Comidas envasadas congeladas Extensión en 2 8VH ODV LQVWUXFFLRQHV GH FRFFLyQ SDUD KRUQR WUDGLFLRQDO QR SDUD )UHtU FRQ $LUH FRPR JXtD GH FRQILJXUDFLyQ GH temperatura y tiempo de cocción. Con algunas comidas, se podrá requerir un tiempo de cocción adicional diferente al tiempo recomendado en el paquete. Si el horno está caliente al iniciar la cocción, la comida se podrá cocinar más rápido que el tiempo mínimo que figura en el paquete. 8WHQVLOLR SULQFLSDO UHFRPHQGDGR Opciones de utensilios alternativos USO DEL ELECTRODOMÉSTICO: Modo de Cocción para Freír con Aire 49-2003957 Rev. 0 21 Asegúrese de que la corriente eléctrica esté apagada y que todas las superficies estén frías antes de limpiar cualquier parte de la cocina. Panel de Control 3DUDEORTXHDUORVFRQWUROHVFRQVXOWHODLQIRUPDFLyQGH4XLFN6HWWLQJVVKDGH SDQHOGH&RQILJXUDFLyQUiSLGD HQODVHFFLyQ$SSOLDQFH 'LVSOD\6HWWLQJV &RQILJXUDFLyQGHSDQWDOODGHOHOHFWURGRPpVWLFR 8QDEXHQDLGHDHVOLPSLDUHOSDQHOGHFRQWUROOXHJRGHFDGD XVR/LPSLHFRQXQMDEyQVXDYH\DJXDRYLQDJUH\DJXDHQMXDJXHFRQDJXDOLPSLD\SXODHQVHFRFRQXQDWHODVXDYH1RXVH limpiadores abrasivos, limpiadores líquidos fuertes, almohadillas para fregar de plástico ni limpiadores de horno en el panel de control; dañarán el acabado. Exterior del Horno 1RXVHOLPSLDGRUHVGHKRUQROLPSLDGRUHVDEUDVLYRV limpiadores líquidos fuertes, estropajos de acero, almohadillas para fregar de plástico, ni polvos limpiadores en el exterior del horno. Limpie el mismo con agua y jabón o una solución de vinagre y agua. Enjuague con agua limpia y seque con una tela seca. Al limpiar supeficies, asegúrese de que estén a temperatura ambiente y fuera del contacto con la luz solar. Si las manchas en el borde de la ventana de la puerta son persistentes, use un limpiador abrasivo suave o una esponja con estropajo para obtener un mejor resultado. El derrame de adobo, jugos de fruta, salsas de tomate y líquidos para humedecer que contengan ácidos pueden ocasionar GHVFRORUDFLyQ\VHGHEHUiQOLPSLDUGHLQPHGLDWR'HMHTXHODV superficies calientes se enfríen, y luego limpie y enjuague. Superficies pintadas y Acero Inoxidable Negro (en algunos modelos) Las superficies pintadas podrán incluir la puerta y el borde alrededor del panel de control. Límpielas con jabón y agua o con una solución de agua y vinagre. 1RXWLOLFHOLPSLDGRUHVGHKRUQRFRPHUFLDOHVSROYRVOLPSLDGRUHV esponjillas de acero o abrasivos potentes sobre cualquier superficie pintada, LQFOX\HQGRHO$FHUR,QR[LGDEOH1HJUR Acero Inoxidable – Excluyendo el Acero Inoxidable Negro (en algunos modelos) 1RXVHYLUXWDVGHDFHURpVWDVGDxDUiQODVXSHUILFLH Para limpiar la superficie de acero inoxidable, use agua tibia con jabón o un limpiador o pulidor para acero inoxidable. Siempre limpie la superficie en la dirección del veteado. Siga las instrucciones del limpiador para limpiar la superficie de acero inoxidable. Los limpiadores con ácido oxálico tales eliminarán el óxido, GHVOXVWUHV\SHTXHxDVPDQFKDVVREUHODVXSHUILFLH8VHVyOR un limpiador líquido libre de material abrasivo y frote en la dirección de las líneas del cepillo con una esponja suave y húmeda. Para realizar consultas sobre la adquisición de productos, incluyendo limpiadores o pulidores para electrodomésticos de acero inoxidable, consulte las secciones de Accesorios y Soporte al Consumidor al final de este manual. Cuidado y limpieza - Exterior CUIDADO Y LIMPIEZA: &XLGDGR\OLPSLH]D([WHULRU 22 49-2003957 Rev. 0 Cuidado y limpieza - Interior (OLQWHULRUGHVXQXHYRKRUQRSXHGHVHUOLPSLDGRGHIRUPDPDQXDORXWLOL]DQGRORVPRGRV6WHDP&OHDQ /LPSLH]DFRQ9DSRU R 6HOI&OHDQ /LPSLH]D$XWRPiWLFD El derrame de adobo, jugos de fruta, salsas de tomate y líquidos para humedecer que contengan ácidos pueden ocasionar descoloración y se deberán limpiar de inmediato. Espere a que las superficies calientes se enfríen, y luego limpie y enjuague. Limpieza Manual 1RXVHOLPSLDGRUHVGHKRUQR DPHQRVTXHHVWpQFHUWLILFDGRV para hornos con limpieza automática), limpiadores líquidos fuertes, ni almohadillas para fregar en el interior del horno. Limpie con agua y jabón suave o con una solución de vinagre y agua. Enjuague con agua limpia y seque con una tela seca. Al limpiar las superficies, asegúrese de que se encuentren a temperatura ambiente. Modo de Limpieza con Vapor Steam Clean está diseñado para calentar suficientemente el agua añadida en el fondo, permitiendo que alcance una temperatura que provoca la condensación del vapor sobre los residuos de alimentos. Este proceso ablanda los residuos, facilitando su eliminación. El horno debe estar frío antes de iniciar un ciclo de Steam Clean. Esto permite limpiar de manera segura la grasa y los residuos del fondo del horno previamente. Además, previene el riesgo de choque térmico y agrietamiento del esmalte que podría resultar de verter agua fría sobre la superficie caliente del horno. Vierta una taza de agua en el fondo del horno. Cierre la puerta. Seleccione Steam Clean (limpieza con vapor) y pulse Start (Inicio) DODGHUHFKDGHODSDQWDOOD1RGHEHDEULUODSXHUWD durante los 30 minutos del ciclo de limpieza a vapor, ya que esto disminuirá el rendimiento de la limpieza. Elimine cualquier exceso de agua y los residuos restantes. NOTA: El agua en el fondo del horno puede estar caliente inmediatamente después de finalizar el ciclo. Modo de Limpieza Automática Lea las Instrucciones de Seguridad del Horno con Limpieza Automática, en el comienzo de este manual, antes de usar HOPRGR6HOI&OHDQ /LPSLH]D$XWRPiWLFD (VWHPRGRXVD temperaturas muy altas para limpiar el interior del horno. Cuando use esta función, la puerta del horno se trabará. Antes de utilizar el ciclo de limpieza automática, limpie la grasa y restos de comida que haya en el horno. Retire todos los artículos del horno, excepto los estantes esmaltados FRORURVFXUR /RVHVWDQWHVEULOODQWHVRGHSODWDODVRQGD para carne, y cualquier utensilio u otros artículos deberán ser retirados del horno antes de iniciar un ciclo de limpieza automática. Cierre la puerta. Si usará un horno doble, seleccione qué horno desea limpiar. Seleccione Self Clean (limpieza automática) . Elija un ciclo de 3, 4 o 5 horas y seleccione Start (Inicio) . Para hornos con suciedad excesiva, se recomienda el tiempo máximo de limpieza de 5 horas. Si desea usar el tiempo predeterminado, presione Start (Inicio) inmediatamente después de seleccionar Self Clean (limpieza automática) . El horno mostrará que la puerta está bloqueada y exhibirá la cantidad de tiempo restante en el ciclo. Presione Cancel (Cancelar) si desea detener el ciclo. El horno se apagará automáticamente cuando el ciclo de limpieza automática finalice. La puerta permanecerá bloqueada hasta TXHHOKRUQRVHKD\DHQIULDGR8QDYH]TXHHOKRUQRVHKD\D enfriado, limpie cualquier ceniza que haya quedado en el horno. 'XUDQWHHOSULPHUFLFORGHOLPSLH]DOHUHFRPHQGDPRVYHQWLODU su cocina con una ventana abierta o usar un ventilador o campana de ventilación. La suciedad en la estructura frontal del horno y la parte externa de la junta de la puerta se deberán limpiar de forma manual. Limpie estas áreas con agua caliente, estropajos de acero con jabón o limpiadores tales como Soft Scrub ® . Enjuague bien con agua caliente y seque. 1ROLPSLHODMXQWD(OPDWHULDOGHILEUDGHYLGULRGHODMXQWDGH la puerta del horno no resiste la abrasión. Es esencial que la junta permanezca intacta. Si observa que comienza a gastarse o deshilacharse, reemplace la misma. Asegúrese de que el cobertor de la lámpara de luz del horno se encuentre en su lugar y que la luz del mismo esté apagada. $OXVDUHOPRGR6HOI&OHDQ /LPSLH]D$XWRPiWLFD HQXQKRUQR doble, sólo el horno superior o inferior podrán utilizar el ciclo XQRSRUYH]'HIRUPDDGLFLRQDOQLQJ~QRWURPRGRSRGUiVHU iniciado en la cavidad del horno alterna mientras el ciclo de limpieza automática se encuentre en progreso. IMPORTANTE: Las emanaciones producidas por el ciclo de autolimpieza de cualquier horno afectan la salud de algunas aves de manera notoria. Procure llevar sus aves a otra habitación bien ventilada. CUIDADO Y LIMPIEZA: /LPSLH]DGHOD&RFLQD,QWHULRU 49-2003957 Rev. 0 23 Probe (Sonda) La sonda de temperatura se puede limpiar con agua y jabón o con una almohadilla de estropajo llena de jabón. Enfríe la sonda de temperatura antes de su limpieza. Fregue las manchas difíciles con una almohadilla de estropajo llena de jabón, enjuague y seque. Para ordenar más sondas de temperatura, consulte las secciones de Accesorios y Soporte al Consumidor al final de este manual. Ŷ 1RVXPHUMDODVRQGDGHWHPSHUDWXUDHQDJXD Ŷ 1RJXDUGHODVRQGDGHWHPSHUDWXUDGHQWURGHOKRUQR Ŷ 1XQFDGHMHODVRQGDGHWHPSHUDWXUDGHQWURGHOKRUQRGXUDQWH un ciclo de limpieza automática o de limpieza con vapor. Cuidado y limpieza - Interior Bandejas del Horno Si las parrillas que se suministraron con su horno son de esmalte oscuro, no brillantes, pueden permanecer en el horno durante el ciclo de autolimpieza sin sufrir daños. Para limpiar manualmente las parrillas, utilice agua tibia y jabonosa. Asegúrese de no lavar las guías de la parrilla en una parrilla extensible. Si las parrillas se vuelven más difíciles de retirar del horno, aplique un poco de aceite vegetal en un paño suave o una toalla de papel y frote los soportes de las parrillas del horno. 1RDSOLTXHHODFHLWHHQODJXtDGHODSDUULOODH[WHQVLEOH NOTA: El uso de otros aceites de cocina como el aceite de cacahuate, Pam ® o aerosoles lubricantes similares puede provocar una descoloración o un residuo de color óxido en las parrillas y los laterales de la cavidad. Para limpiar este residuo, utilice una solución de agua y jabón o de agua y vinagre. Enjuague con agua limpia y seque con un paño suave. Periódicamente, puede ser necesario lubricar las parrillas del horno utilizando el lubricante suministrado con su horno. Para solicitar lubricante adicional, consulte la sección de accesorios de este manual. Uso del horno: 1. Quite la bandeja del horno. Ver la sección Bandejas del Horno de Extensión. 2. Extienda por completo la bandeja sobre una mesa o mostrador de encimera. Puede colocarse papel de diario debajo de la bandeja para una limpieza sencilla. 3. Si hay residuos en las guías de deslizamiento, límpielas con una toalla de papel. NOTA: Todo el lubricante que se haya eliminado durante la limpieza debe volver a colocarse. 4. Agite el lubricante antes de abrirlo. Comenzando con el mecanismo de deslizamiento izquierdo de la guía, coloque FXDWUR JRWDVGHOXEULFDQWHVREUHODVGRV JXtDV traseras cercanas a los cojinetes de apoyo. 5. Repita en el mecanismo del lado derecho de la guía. 6. Abra y cierre la guía varias veces para distribuir el lubricante. 5HHPSODFHODWDSDGHOOXEULFDQWH\DJtWHODQXHYDPHQWH'p YXHOWDODEDQGHMD\UHSLWDORVSDVRV\ 6RORSDUD soportes de parrilla moldeados en la pared de la cavidad del horno.) Además, para un deslizamiento óptimo, asegúrese de añadir un par de gotas de lubricante en el soporte y el UHVRUWHGHSDOHWDTXHVHPXHVWUDQDFRQWLQXDFLyQ 8. Cierre la bandeja, gire la bandeja dejando el lado derecho hacia arriba y colóquela en el horno. Ver la sección Bandejas del Horno de Extensión. 9. Repita los pasos anteriores para cada bandeja. Guía lado derecho arriba Lado derecho Lado izquierdo Guía lado derecho arriba KWWSVSURGXFWVJHDSSOLDQFHV FRPDSSOLDQFHJHDVXSSRUW VHDUFKFRQWHQW"FRQWHQW,G Soporte Resorte de paleta CUIDADO Y LIMPIEZA: &XLGDGR\OLPSLH]D,QWHULRU 24 49-2003957 Rev. 0 ADVERTENCIA PELIGRO DE DESCARGA O QUEMADURAS: Antes de reemplazar la lámpara de luz del horno, desconecte la conexión eléctrica del horno del fusible principal o del panel del disyuntor. Si esto no se cumple, se podrá producir una descarga eléctrica o un incendio. PRECAUCIÓN RIESGO DE INCENDIO: La tapa de vidrio y la lámpara de luz se deberán retirar cuando estén frías. Tocar el vidrio caliente sin protección en las manos o con un trapo húmedo puede ocasionar quemaduras. Luz del Horno 'HVFRQHFWHODFRUULHQWHGHVGHHOIXVLEOHSULQFLSDORHOSDQHO del disyuntor. 2. Retire los estantes del horno. 'HVOLFHXQGHVWRUQLOODGRUGHSXQWDSODQDRXQFXFKLOORSDUD untar manteca entre la carcasa metálica y la tapa de luz de vidrio. NOTA: algunos modelos cuentan con un sujetador metálico que visiblemente sostiene el vidrio. Es necesario insertar la herramienta entre la carcasa metálica y el sujetador que sostiene el vidrio. 4. Apoye la tapa de luz de vidrio con dos dedos para evitar que se caiga al fondo del horno. Tenga cuidado de no astillar la cubierta del horno. 'HIRUPDVXDYHJLUHODSXQWDGHOGHVWRUQLOODGRURGHO cuchillo para untar manteca, a fin de aflojar la tapa de luz de vidrio. Tenga cuidado de no astillar la cubierta del horno. 6. Retire la tapa de luz de vidrio. 7. Retire la lámpara sosteniendo firmemente y deslizando la misma hacia afuera, hasta que las dos clavijas hayan dejado el soporte de cerámica. 1RWRTXHHOYLGULRGHODQXHYDOiPSDUDFRQORVGHGRV(VWR hará que la lámpara falle al dar luz. Tome la lámpara de reemplzado con una toalla limpia o un pañuelo de papel con las clavijas hacia abajo. Aliñe las dos clavijas en el soporte de cerámica, presionando suavemente hasta que la lámpara quede asegurada en la ficha de cerámica. 'HVOLFHODVOHQWHVSURWHFWRUDVGHOVRSRUWH\SUHVLRQHKDVWD que las pinzas queden enganchadas en la caja. 10. Vuelva a conectar la corriente. CUIDADO Y LIMPIEZA: Luz del Horno 49-2003957 Rev. 0 25 Puerta del Horno CUIDADO Y LIMPIEZA: Luz del Puerta Retiro de la Puerta del Horno Inferior NOTA: La remoción de la puerta no es un requerimiento de la instalación del producto, pero es una comodidad adicional. Para quitar la puerta: 1. Abra la puerta del horno en su totalidad. 5HWLUHHOVRSRUWHGHODELVDJUD GHHVWDUSUHVHQWH GHOD estructura frontal y déjelo a un lado. El soporte de la bisagra debe ser colocado nuevamente para un funcionamiento apropiado de la puerta cuando está última sea reinstalada. 3. Presione ambas trabas de la bisagra hacia abajo en dirección del marco de la puerta hasta destrabarlas. Para esto puede hacer falta un destornillador de lados planos. ¡NO LEVANTE LA PUERTA DE LA MANIJA! 4. Coloque las manos sobre ambos lados y cierre la puerta GHOKRUQRKDVWDODSRVLFLyQGHUHPRFLyQ DSUR[LPDGDPHQWH 1”–2” [2,5 cm–5,1 cm] de la posición de cierre). 5. Levante la puerta hasta que los brazos de la bisagra hayan salido de las ranuras. NOTA: La puerta del horno es muy pesada. Asegúrese de tener un agarre firme antes de levantar la puerta del horno de sus bisagras. Tenga cuidado XQDYH]TXHKD\DTXLWDGRODSXHUWD1RGHSRVLWHODSXHUWD sobre la manija. Esto puede provocar abolladuras o rayones. Reemplazo de la Puerta del Horno Inferior NOTA: La puerta del horno es pesada. Puede necesitar ayuda para levantar la puerta lo suficiente como para deslizarla dentro GHODVUDQXUDVGHODELVDJUD1ROHYDQWHODSXHUWDGHODPDQLMD 1. Levante la puerta del horno tomándola de ambos lados. 2. Con la puerta en el mismo ángulo de la posición de UHPRFLyQ DSUR[LPDGDPHQWH´±´>FP±FP@GHVGH la posición de cerrado), introduzca la muesca del brazo de la bisagra dentro del extremo inferior de la ranura de la bisagra. La ranura del brazo de la bisagra debe estar bien colocada en la parte inferior de la ranura. 3. Abra la puerta por completo. Si la puerta no se abre por completo, la muesca no está bien colocada en el extremo inferior de la ranura. 4. Presione las trabas de la bisagra hacia arriba contra el armazón frontal de la cavidad del horno, hasta alcanzar la posición de trabado. 5HHPSODFHHOVRSRUWHGHODELVDJUD GHHVWDUSUHVHQWH (O soporte de la bisagra debe ser colocado nuevamente para un funcionamiento apropiado de la puerta. 6. Cierre la puerta del horno. Bisagra en la posición de trabado Ranura de la bisagra bien colocada en la parte inferior de la ranura de la bisagra Lado inferior de la ranura Brazo de la bisagra Ranura de la bisagra Soporte de la Bisagra Ranura de la bisagra Brazo de la bisagra Posición destrabada de la bisagra La bisagra sale de la ranura Soporte de la Bisagra 26 49-2003957 Rev. 0 ¡Ahorre tiempo y dinero! Revise los cuadros en las páginas siguientes antes de llamar al servicio técnico. Consulte videos de autoayuda y preguntas frecuentes en bodewell.com/faqs. Problema Causa Posible Qué Hacer Mi horno nuevo no cocina como el anterior. ¿Hay algún problema con las configuraciones de temperatura? Su horno nuevo cuenta con un sistema de cocción diferente con relación al anterior y, por lo tanto, es posible que cocine de forma diferente. En los primeros usos, use los tiempos y temperaturas de su receta con cuidado. Si aún piensa que su horno nuevo cocina con demasiado calor o demasiado frío, podrá ajustar el termostato usted mismo para aplicar su preferencia de cocción específica. Para ajustar la temperatura del horno, consulte la sección de Funciones Especiales. NOTA: Este ajuste afecta ODVWHPSHUDWXUDVGHORVPRGRV7UDGLWLRQDO%DNH +RUQHDGR 7UDGLFLRQDO &RQYHFWLRQ%DNH +RUQHDUSRU&RQYHFFLyQ \ &RQYHFWLRQ%DNH0XOWL +RUQHDGRSRU&RQYHFFLyQ0~OWLSOH pVWHQRDIHFWDUiORVPRGRV&RQYHFWLRQ5RDVW 'RUDUSRU &RQYHFFLyQ 7UDGLWLRQDO%URLO $VDGR7UDGLFLRQDO &RQYHFWLRQ %URLO $VDUSRU&RQYHFFLyQ R&OHDQ /LPSLDU La comida no se hornea de forma apropiada Controles del horno configurados de forma incorrecta. Consulte la sección Modos de Cocción. La posición del estante es incorrecta o el estante no está nivelado. Consulte la sección Modos de Cocción y la Guía de Cocción. 8VRGHXQDFDFHURODLQFRUUHFWDRGHXQDFDFHURODGH tamaño incorrecto. &RQVXOWHODVHFFLyQ8WHQVLOLRV La temperatura del horno debe ser ajustada. &RQVXOWHODRSFLyQ&RRNLQJ &RFFLyQ HQODVHFFLyQ6HWWLQJV &RQILJXUDFLRQHV Sustitución de ingredientes Sustituir ingredientes puede modificar el resultado de la receta. La comida no asa de forma apropiada Controles del horno configurados de forma incorrecta. Asegúrese de seleccionar el modo correcto para asar. Se usó una posición incorrecta del estante. Para acceder a sugerencias de ubicación de estantes, consulte la Guía de Cocción. Se cocinó comida en una olla caliente. Asegúrese de que el utensilio esté frío 8WHQVLOLRGHFRFLQDLQDGHFXDGRSDUDDVDU 8VHXQDROODHVSHFtILFDPHQWHGLVHxDGDSDUDDVDU El papel de aluminio usado para la olla y la rejilla para asar no se ajustó ni cortó de forma apropiada, según lo recomendado. Si usará papel de aluminio, deberá usarse conforme con las aberturas de la olla. En algunas áreas, es posible que el nivel de corriente YROWDMH VHDEDMR Precaliente el elemento para asar durante 10 minutos. La temperatura del horno es demasiado caliente o demasiado fría La temperatura del horno debe ser ajustada. &RQVXOWHODRSFLyQ&RRNLQJ &RFFLyQ HQODVHFFLyQ6HWWLQJV &RQILJXUDFLRQHV El horno no funciona o parece no funcionar Es posible que un fusible de su hogar se haya quemado o que el disyuntor se haya desconectado. Reemplace el fusible o reinicie el disyuntor. Controles del horno configurados de forma incorrecta. &RQVXOWHODVVHFFLRQHV8VRGHOHOHFWURGRPpVWLFR\ Configuración de un modo de cocción. (OKRUQRVHHQFXHQWUDHQ6DEEDWK0RGH 0RGR Sabático) 9HULILTXHTXHHOKRUQRQRHVWpHQ6DEEDWK0RGH 0RGR 6DEiWLFR &RQVXOWHODRSFLyQ6DEEDWK 6DEiWLFR HQODVHFFLyQ 6HWWLQJV &RQILJXUDFLRQHV Sonido de “chisporroteo” o “traqueo” Éste es el sonido de metal calentándose o enfriándose durante las funciones de cocción y limpieza.. Esto es normal. ¿Por qué la estufa hace un sonido de “clic” cuando uso el horno? Su estufa fue diseñada para mantener un control más ajustado sobre la temperatura del horno. Es posible que escuche que los elementos calefactores de su horno hacen un “clic” de encendido y apagado con mayor frecuencia que en hornos antiguos, a fin de lograr mejores resultados durante los ciclos de cocción y limpieza. Esto es normal. El reloj y el temporizador no funcionan Es posible que un fusible de su hogar se haya quemado o que el disyuntor se haya desconectado. Reemplace el fusible o reinicie el disyuntor. La luz del horno no funciona La lámpara está floja o presenta defectos. Ajuste o reemplace la lámpara. El modo de limpieza automática del horno no funciona La temperatura del horno es demasiado caliente como para configurar la limpieza automática. Espere a que el horno se enfríe y reinicie los controles. Los controles del horno están configurados de forma incorrecta. Consulte la sección de Limpieza del Horno. Exceso de humo durante un ciclo de limpieza Suciedad o grasa excesiva. Presione Cancel (Cancelar) para detener el ciclo. Abra las ventanas para liberar el humo en la habitación. Espere hasta que la puerta se destrabe. Limpie el exceso de suciedad y reinicie el ciclo de limpieza. Consejos para la Solución de Problemas... Antes de solicitar el servicio técnico CONSEJOS PARA LA SOLUCIÓN DE PROBLEMAS 49-2003957 Rev. 0 27 Problema Causa Posible Qué Hacer Humo excesivo al asar La comida está demasiado cerca del quemador. Baje la posición del estante con comida. La puerta del horno no se abrirá luego de un ciclo de limpieza El horno está demasiado caliente. Espere a que el horno se enfríe por debajo de la temperatura de bloqueo. El horno no limpia luego de un ciclo de limpieza Los controles del horno están configurados de forma incorrecta. Consulte la sección de Limpieza del Horno. El horno estaba demasiado sucio. Limpie derrames excesivos antes de iniciar el ciclo de limpieza. Es posible que, en hornos con mucha suciedad, sea necesario usar la limpieza automática nuevamente o usarla durante un período de tiempo más prolongado. “F – y un número o letra” son exhibidos en la pantalla de LCD Tiene un código de error de función. Presione Dismiss (Descartar) HQODSDQWDOODGH/&'9XHOYDD poner el horno en funcionamiento. Si el código de función se repite. 'HVFRQHFWHWRWDOPHQWHODFRUULHQWHGHODFRFLQDGXUDQWHSRUOR menos 30 minutos y vuelva a conectar la misma. Si el código de error de función se repite, llame al servicio técnico. El LCD no está funcionando correctamente Es posible que un fusible de su hogar se haya quemado o que el disyuntor se haya desconectado. Reemplace el fusible o reinicie el disyuntor. Los controles del horno están configurados de forma incorrecta. Consulte la sección de Modos de Cocción o Configuraciones para asegurar un uso correcto. Asegúrese de que la unidad se encuentre actualizada con el software más reciente. /DSDQWDOODGH/&'HVWiEORTXHDGD 'HVEORTXHHODSDQWDOODSUHVLRQDQGRHOtFRQR Unlock (Desbloquear) . Si esto no corrige el problema, haga circular corriente por el disyuntor y asegúrese de que la unidad se encuentre actualizada con el software más reciente. La pantalla táctil no responde correctamente Coloque toda su mano sobre la pantalla táctil durante 5 segundos y luego retírela para restablecer la sensibilidad de la pantalla táctil. (O/&'HVGHIHFWXRVR Haga circular corriente por el disyuntor y asegúrese de que la unidad se encuentre actualizada con el software más reciente. Si el problema persiste, comuníquese con el servicio técnico para evaluar el mismo. Corte de corriente, el reloj se reinicia Corte o exceso de corriente Reinicie el reloj. Si el horno se encontraba en uso, deberá reiniciar el mismo presionando la tecla Cancel (Cancelar) , configurando el reloj y reiniciando cualquier función de cocción. Olor a “quemado” o “aceite” desde la ventilación Esto es normal en un horno nuevo y desaparecerá con el tiempo. Para acelerar el proceso, configure un ciclo de limpieza automática por un mínimo de 3 horas. Consulte la sección de Limpieza del Horno. Olor fuerte 8QRORUHQODDLVODFLyQDOUHGHGRUGHOLQWHULRUGHOKRUQR es normal desde las primeras veces en que el horno es usado. Esto es temporario y desaparecerá luego de varios usos o de un ciclo de limpieza automática. Ruido del ventilador Es posible que un ventilador de enfriamiento se active automáticamente. Esto es normal. El ventilador de enfriamiento se encenderá para enfriar las partes internas. Es posible que funcione hasta durante una hora y media, una vez que el horno se haya apagado. La puerta de vidrio del horno parece estar “teñida” o tener un color “arcoíris”. ¿Es esto un defecto? 1R(OYLGULRGHOKRUQRLQWHUQRHVWiFXELHUWRFRQXQD barrera de calor que refleja este último nuevamente hacia el horno, a fin de evitar la pérdida de calor y de mantener fría la puerta externa mientras se hornea. Esto es normal. Bajo ciertas luces y ángulos, es posible que visualice esta tinta o arcoíris. A veces el horno tarda más en precalentarse a la misma temperatura 8WHQVLOLRRFRPLGDHQHOKRUQR El utensilio o la comida en el horno hará que éste tarde más en precalentarse. Retire estos artículos para reducir el tiempo de precalentamiento. 1~PHURGHHVWDQWHVHQHOKRUQR Agregar más estantes al horno hará que éste tarde más en precalentarse. Retire algunos estantes. 'LIHUHQWHVPRGRVGHFRFFLyQ Los diferentes modos de cocción utilizan diferentes métodos de precalentamiento para calentar el horno en un modo de cocción específico. Algunos modos tardarán más que otros WDOHVFRPRKRUQHDGRSRUFRQYHFFLyQP~OWLSOH El horno no funciona en forma remota Problemas en el enrutador, no hay señal inalámbrica, etc. Para solicitar asistencia con la conectividad de red inalámbrica, FRPXQtTXHVHDO El horno no está conectado. Consejos para la Solución de Problemas... Antes de solicitar el servicio técnico CONSEJOS PARA LA SOLUCIÓN DE PROBLEMAS 28 49-2003957 Rev. 0 GARANTÍA LIMITADA Abroche su recibo aquí. Para acceder al servicio técnico de acuerdo con la garantía deberá contar con la prueba de la fecha original de compra. Todo el servicio de garantía de su electrodoméstico es provisto exclusivamente por GE Appliances, Centros de Servicio de Fábrica de la compañía Haier, o por un técnico del servicio autorizado por GE Appliances para brindar el servicio de garantía de su electrodoméstico. Para SURJUDPDUHOVHUYLFLRWpFQLFRGHQWURGH((88YLVtWHQRVHQ Bodewell.com/schedule-repair-service, o llame al 833-4BODEWELL (Q&DQDGiYLVLWH GEAppliances.ca/en/support/service-request o llame al 800.561.3344. Cuando llame para solicitar el servicio, tenga los números de serie y modelo disponibles. El servicio técnico que no haya sido programado o de otro modo organizado por GE Appliances no estará cubierto bajo esta garantía, incluyendo cualquier parte y/o servicios provistos. Para realizar el servicio técnico de su electrodoméstico, se podrá requerir el uso de datos del puerto de abordaje para su diagnóstico. Esto da al técnico del servicio de fábrica de GE Appliances la habilidad de diagnosticar de forma rápida cualquier problema con su electrodoméstico, y de ayudar a GE Appliances a mejorar sus productos al brindarle a GE Appliances la información sobre su electrodoméstico. Si no desea que los datos de su electrodoméstico sean enviados a GE Appliances, solicitamos que le indique a su técnico no entregar los datos a GE Appliances en el momento del servicio. Qué no cubrirá GE Appliances: Ŷ 9LDMHVGHOWpFQLFRGHOVHUYLFLRDVXKRJDUSDUDHQVHxDUOH sobre cómo usar el producto. Ŷ ,QVWDODFLyQHQWUHJDRPDQWHQLPLHQWRLQDGHFXDGRV Ŷ )DOODVGHOSURGXFWRHQFDVRGHDEXVRPDOXVRPRGLILFDFLyQ o uso para propósitos diferentes al original o uso comercial. Ŷ 5HHPSOD]RGHIXVLEOHVGHODFDVDRUHLQLFLRGHGLV\XQWRUHV Ŷ 'DxRVRFDVLRQDGRVVREUHHOSURGXFWRSRUDFFLGHQWH incendio, inundaciones o catástrofes naturales. Ŷ 'DxRVLQFLGHQWDOHVRFRQVHFXHQWHVFDXVDGRVSRUSRVLEOHV defectos sobre este producto. Ŷ 'DxRFDXVDGRGHVSXpVGHODHQWUHJD Ŷ 3URGXFWRQRDFFHVLEOHSDUDEULQGDUHOVHUYLFLRUHTXHULGR Ŷ 6ROLFLWHHOVHUYLFLRWpFQLFRSDUDUHSDUDURUHHPSOD]DUODV OiPSDUDVH[FHSWRODVOiPSDUDV/(' Ŷ 'DxRVVREUHHODFDEDGRWDOHVFRPRy[LGRVREUHOD superficie, deslustres o manchas pequeñas no informadas dentro de las 48 horas luego de la entrega. EXCLUSIÓN DE GARANTÍAS IMPLÍCITAS Su única y exclusiva alternativa es la reparación del producto, como se indica en la Garantía Limitada. Las garantías implícitas, incluyendo garantías implícitas de comerciabilidad o conveniencia sobre un propósito particular, se limitan a un año o al período más corto permitido por la ley. PARA CLIENTES EN EE. UU.: Esta garantía limitada se extiende al comprador original y a cualquier propietario posterior de los productos comprados para uso doméstico dentro de ((88 Si el producto está en un área donde no se encuentra disponible un Proveedor Autorizado del Servicio Técnico de GE Appliances, usted será responsable por el costo de un viaje o se podrá requerir que traiga el producto a una ubicación del Servicio Técnico de GE Appliances autorizado para recibir el servicio. En Alaska, la garantía limitada excluye el costo de envío o visitas de servicio a su domicilio. Algunos estados no permiten la exclusión o limitación de daños fortuitos o consecuentes. Esta garantía limitada le otorga derechos legales específicos, y usted también podría tener otros derechos que varían de estado a estado. Para conocer cuáles son sus derechos legales, consulte a la oficina de asuntos del consumidor local o estatal o al Fiscal de su estado. Garante: GE Appliances, a Haier company Louisville, KY 40225 EN CANADÁ (INCLUYENDO LA PROVINCIA DE QUÉBEC): Esta garantía limitada se extiende al comprador original y a cualquier propietario posterior de los productos adquiridos en Canadá, incluyendo Québec, para uso doméstico dentro de Canadá, incluyendo Québec. Si el producto se encuentra en un área donde no está disponible el servicio de un Proveedor de Servicio Autorizado de GE Appliances, usted será responsable por el costo de un viaje o se podrá requerir que lleve el producto a una ubicación de Servicio Autorizado de GE Appliances. Algunas provincias, incluyendo Québec, no permiten la exclusión o limitación de daños fortuitos o consecuentes. Esta garantía limitada le otorga derechos legales específicos, y usted también podría tener otros derechos que varían de una provincia a otra, incluyendo Québec. Para saber cuáles son sus derechos legales, consulte en la oficina de protección al consumidor local o de su provincia. SOLO PARA CONSUMIDORES DE QUÉBEC – AVISO SOBRE LA GARANTÍA DE DISPONIBILIDAD DE PIEZAS DE REPUESTO, SERVICIOS DE REPARACIÓN E INFORMACIÓN NECESARIA PARA LA REPARACIÓN O MANTENIMIENTO (ART. 39 DE LA LEY DE PROTECCIÓN AL CONSUMIDOR): 6H OH LQIRUPD TXH 0& &RPPHUFLDO ,QF ³0& &RPPHUFLDO´ QR garantiza, en el sentido del artículo 39 de la Ley de Protección DO&RQVXPLGRU&4/5F3\GHORVDUWtFXORVD del Reglamento relativo a la aplicación de la Ley de Protección DO&RQVXPLGRU&4/5F3UODGLVSRQLELOLGDGGHSLH]DV de repuesto, servicios de reparación o la información necesaria para el mantenimiento o reparación de bienes fabricados, importados, publicitados o vendidos por MC Commercial. Tenga en cuenta que MC Commercial Inc. continúa ofreciendo la garantía limitada del fabricante según lo indicado en el Manual del Propietario o Guía Rápida, y que esta garantía limitada es distinta de la garantía legal de disponibilidad prevista en el artículo 39 de la Ley de Protección al Consumidor. Garante: MC Commercial Inc., Burlington, ON, L7L 6B2 GARANTÍAS EXTENDIDAS: Adquiera una garantía extendida de GE Appliances y conozca los descuentos especiales que están disponibles mientras su garantía aún está vigente. Puede adquirirla en línea en cualquier momento en bodewellcareplan.com RFRPXQLFDUVHDOGXUDQWHHOKRUDULRGHDWHQFLyQ comercial. El Servicio de GE Appliances seguirá estando GLVSRQLEOH GHVSXpV GH TXH VX JDUDQWtD FDGXTXH (Q &DQDGi comuníquese con su proveedor local de garantía extendida. Garantía Limitada del Horno de Pared Por el Período de GE Appliances reemplazará Un Año 'HVGHODIHFKDGHOD compra original Cualquier parte GHOKRUQRTXHIDOOHGHELGRDXQGHIHFWRHQORVPDWHULDOHVRODIDEULFDFLyQ'XUDQWHHVWD garantía limitada de un año , GE Appliances también proveerá, sin costo , todo el trabajo y el servicio en el hogar para reemplazar la parte que presente defectos. Dos Año 'HVGHODIHFKDGHOD compra original de la marca Monogram Cualquier parte GHOKRUQRTXHIDOOHGHELGRDXQGHIHFWRHQORVPDWHULDOHVRODIDEULFDFLyQ'XUDQWH esta garantía limitada de dos años , GE Appliances también proveerá, sin costo , todo el trabajo y el servicio en el hogar para reemplazar la parte que presente defectos. 49-2003957 Rev. 0 29 ACCESORIOS ¿Busca Algo Más? ¡GE Appliances ofrece una variedad de accesorios para mejorar sus experiencias de cocción y mantenimiento! Para acceder a números telefónicos e información de sitios Web, consulte la página de Soporte para el Consumidor. (VWRV\RWURVSURGXFWRVHVWiQGLVSRQLEOHV Accesorios Accesorios 2OODSDUD$VDU3HTXHxD ô´[ó´[ò³ 2OODSDUD$VDU*UDQGH ô´[ó´[ò³ 2OODSDUD$VDU([WUD*UDQGH ô´[ó´[ò³ Piezas Estantes del horno Elementos del horno Lámparas de luz Sonda Suministros de Limpieza Limpiadores de Acero Inoxidable Limpiador de Electrodomésticos de Acero Inoxidable Lubricante *La olla para asar grande no entra en cocinas de 20”/24”. **La olla XL no entra en hornos de pared de 24”, empotrables de 27” o cocinas de 20”/24”. 30 49-2003957 Rev. 0 Soporte para el Consumidor SOPORTE PARA EL CONSUMIDOR En los Estados Unidos – Visítenos en GEAppliances.com o llame al 800.626.2005 En Canadá – Visítenos en GEAppliances.ca o llame al 877.994.5366 Encuentre información de soporte para propietarios en nuestro sitio web : • Información • Registre el electrodoméstico • Programe el servicio a través de Bodewell • Compre repuestos, accesorios o garantías extendidas • Conecte su electrodoméstico – 800.220.6899 Si usted no está satisfecho con el servicio, contáctenos en nuestro sitio web con todos los detalles, incluyendo su número de teléfono, o escriba a : En los EE. UU. - General Manager, Customer Relations | GE Appliances | Appliance Park | Louisville, KY 40225 En Canadá 'LUHFWRU&XVWRPHU5HODWLRQV | MC Commercial Inc. | %XUORDN'U6XLWH_%XUOLQJWRQ21//% GEAppliances.com GEAppliances.ca